(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE42

MICSR_1.PE42         Location/Qualifiers
FT   CDS             83178..83663
FT                   /codon_start=1
FT                   /gene_family="HOG000216641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636047"
FT                   /orf_name="MICPUN_56615"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61605.1"
FT                   /db_xref="HOGENOM:HBG735283"
FT                   /db_xref="UniParc:UPI000199AB31"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R9"
FT                   /transl_table=1
FT                   /translation="MGRCPTGGGKKTSKQKNRGYACKSVKRTKFQLPHADVIYKAVHQH
FT                   LKEQAEGGGAKRPGKAREISSYEAMIKGDPNQPFNEDLPGGGQFYCMFTGRHFESAEAL
FT                   ARHQKTKQFKRDKKRVLNGPKPHEQRDAEAAAGMGAPDNGRPLNRAPKQAPAAMAVE"
     MGRCPTGGGK KTSKQKNRGY ACKSVKRTKF QLPHADVIYK AVHQHLKEQA EGGGAKRPGK        60
     AREISSYEAM IKGDPNQPFN EDLPGGGQFY CMFTGRHFES AEALARHQKT KQFKRDKKRV       120
     LNGPKPHEQR DAEAAAGMGA PDNGRPLNRA PKQAPAAMAV E                           161
//

If you have problems or comments...

PBIL Back to PBIL home page