(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE420

MICSR_1.PE420        Location/Qualifiers
FT   CDS             join(821684..822127,822308..822755,822933..823807)
FT                   /codon_start=1
FT                   /gene_family="HOG000237536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637338"
FT                   /orf_name="MICPUN_80171"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61802.1"
FT                   /db_xref="HOGENOM:HBG560198"
FT                   /db_xref="InterPro:IPR019140"
FT                   /db_xref="UniParc:UPI000199AA69"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U7"
FT                   /transl_table=1
FT                   /translation="MSAPLPSCVTDPLGAVASAFDAAIGSGDTAPDQDGDWGIKATLQE
FT                   ALDRPGVMEQIPEINAVGVDNVRPGQLVRFRCMVQDMYNPEYYVGAYKDRSTGGKWRTT
FT                   KFTERISGGNSVNTGESQPDDSAERVIWERRVLYCVPIPGESSWIARDDEDMVAKILAA
FT                   AGERKEGPAAKVDEKVDEKAASSNPVAKHPRADHATCPPASIVPEAAESMDESLNLPLG
FT                   ATDVADGLPRAAPAIVKVYESEDALPVKLNDVLELVGVLQIEPDISNDVSNTNNDQQQA
FT                   AMAAAAAAVNGDPATSGAIEAPAEIRTALIQHLAVPLGGDVLAAEYVLAAIVSRVHTRT
FT                   DSLALGKLSVTLMGVPEGGDLPRNLAAAIADIAPCVAHLPLSIAGLNARSWTPKKDYGV
FT                   NRLRSGPLQLAPGTVVVLDETALTSGQLRETGVRNVQALKQLVQLQELEYDFQYHQMRV
FT                   PVDVAVVVLTSAKQGDSVVQGGECRVPLRMVKDTRVAEQLDPVMARTMRRFVARAWGSD
FT                   HSISEKAGKEIESEMVAARQGERKATELEFHRWLTIARLCALSSGETDLTVKHWKHAME
FT                   CERKTEERLRLM"
     MSAPLPSCVT DPLGAVASAF DAAIGSGDTA PDQDGDWGIK ATLQEALDRP GVMEQIPEIN        60
     AVGVDNVRPG QLVRFRCMVQ DMYNPEYYVG AYKDRSTGGK WRTTKFTERI SGGNSVNTGE       120
     SQPDDSAERV IWERRVLYCV PIPGESSWIA RDDEDMVAKI LAAAGERKEG PAAKVDEKVD       180
     EKAASSNPVA KHPRADHATC PPASIVPEAA ESMDESLNLP LGATDVADGL PRAAPAIVKV       240
     YESEDALPVK LNDVLELVGV LQIEPDISND VSNTNNDQQQ AAMAAAAAAV NGDPATSGAI       300
     EAPAEIRTAL IQHLAVPLGG DVLAAEYVLA AIVSRVHTRT DSLALGKLSV TLMGVPEGGD       360
     LPRNLAAAIA DIAPCVAHLP LSIAGLNARS WTPKKDYGVN RLRSGPLQLA PGTVVVLDET       420
     ALTSGQLRET GVRNVQALKQ LVQLQELEYD FQYHQMRVPV DVAVVVLTSA KQGDSVVQGG       480
     ECRVPLRMVK DTRVAEQLDP VMARTMRRFV ARAWGSDHSI SEKAGKEIES EMVAARQGER       540
     KATELEFHRW LTIARLCALS SGETDLTVKH WKHAMECERK TEERLRLM                    588
//

If you have problems or comments...

PBIL Back to PBIL home page