(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE421

MICSR_1.PE421        Location/Qualifiers
FT   CDS             823907..825292
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637339"
FT                   /orf_name="MICPUN_57002"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61803.1"
FT                   /db_xref="HOGENOM:HBG608447"
FT                   /db_xref="UniParc:UPI000199AA6A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U8"
FT                   /transl_table=1
FT                   /translation="MGAPDLLTRSFAPRITFVDMAEKWRDNQPAVSVAFAGVNRARRAR
FT                   AAAADASADAAEASLGRADLMPRDDTVDATRIASGASSSRGDDGDKGSESRAAWSVALG
FT                   TGLERWIADRGIVVSEPKHFVDVEALYDLYVRDVHPEGKAPNLVTFSSMAGKTLRRVLA
FT                   PATLARRVGKLSVTCEALPATRENWPPRMANKKAEKIKKHGPKDPGRSRPHDLVKQDKD
FT                   STGATCARYVSEMLKLACGPELVRLRVFPDAKELTEAFAASNAIRTHLWSRYKPNDERV
FT                   CLIAVGDGNTPRSAALCAFLTRWQCVAVDPEMVPWRDWRRRHKIQDATWSSCEVKEGDE
FT                   IDEEGDTHGWGGVRRLQVHRRKMQEMVVECELALIVMIHAHISLKDVLAAVKTKSGECA
FT                   AVILPCCNWYSRLAHPDGATAPCHEYEDDAVVSPQRTVRVFSSLPCGVSGAGDGVPCPE
FT                   VVA"
     MGAPDLLTRS FAPRITFVDM AEKWRDNQPA VSVAFAGVNR ARRARAAAAD ASADAAEASL        60
     GRADLMPRDD TVDATRIASG ASSSRGDDGD KGSESRAAWS VALGTGLERW IADRGIVVSE       120
     PKHFVDVEAL YDLYVRDVHP EGKAPNLVTF SSMAGKTLRR VLAPATLARR VGKLSVTCEA       180
     LPATRENWPP RMANKKAEKI KKHGPKDPGR SRPHDLVKQD KDSTGATCAR YVSEMLKLAC       240
     GPELVRLRVF PDAKELTEAF AASNAIRTHL WSRYKPNDER VCLIAVGDGN TPRSAALCAF       300
     LTRWQCVAVD PEMVPWRDWR RRHKIQDATW SSCEVKEGDE IDEEGDTHGW GGVRRLQVHR       360
     RKMQEMVVEC ELALIVMIHA HISLKDVLAA VKTKSGECAA VILPCCNWYS RLAHPDGATA       420
     PCHEYEDDAV VSPQRTVRVF SSLPCGVSGA GDGVPCPEVV A                           461
//

If you have problems or comments...

PBIL Back to PBIL home page