(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE423

MICSR_1.PE423        Location/Qualifiers
FT   CDS             complement(826512..827135)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637341"
FT                   /orf_name="MICPUN_107924"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62232.1"
FT                   /db_xref="UniParc:UPI000199AA6C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V0"
FT                   /transl_table=1
FT                   /translation="MQAITSLFTVKPVTRRPKVAKRGSLQVVAHGGVGGSGGTQYPGKD
FT                   KPYGSDQAPWKKKLILHDDDQADPEANQRSGQRWTPPPPKQESFAAAAPAQSTSSWDSP
FT                   SSGSGGSSNAYSWDSGGSSSYSSAGSAKGRPTHYDPDQYDPDANQRGYMGGGGGGGYSA
FT                   PKPSYGGSTGGGYAAAKPQRVTRGSDGVTYDPDQYDPDANQRSR"
     MQAITSLFTV KPVTRRPKVA KRGSLQVVAH GGVGGSGGTQ YPGKDKPYGS DQAPWKKKLI        60
     LHDDDQADPE ANQRSGQRWT PPPPKQESFA AAAPAQSTSS WDSPSSGSGG SSNAYSWDSG       120
     GSSSYSSAGS AKGRPTHYDP DQYDPDANQR GYMGGGGGGG YSAPKPSYGG STGGGYAAAK       180
     PQRVTRGSDG VTYDPDQYDP DANQRSR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page