(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE424

MICSR_1.PE424        Location/Qualifiers
FT   CDS             827449..829164
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637342"
FT                   /orf_name="MICPUN_57005"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61804.1"
FT                   /db_xref="UniParc:UPI000199AA6D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V1"
FT                   /transl_table=1
FT                   /translation="MGGFSEYRRKKATMLSAAKRLRVEDRGGQERRSARVGRGAEDGTV
FT                   ASDRGLPTRGWQVSVTEPVAGSRRGLSRPLVAGEPIMKKSDRREATSDRRRAGGYGAAD
FT                   GAPIAWDAADDLPMHPRTRGRSSAAASSSSAFPSCAALVTGVALMMMVAVCALAVVHPE
FT                   LARAGATHAAAAWTGRVSSFVSSFRRETVDTQSARLAFLAPHGHDGRHRHAQKTAAKMG
FT                   PGCELLSVEEAAASVAAAFAKGESSIGAACEAAKQFRWDDVDPYVDAAAKDRVGGNEDE
FT                   GKVVVFHAGSRFDPDAVTRAAEMMARDDEVDPKVSPGEGSAGAEKRKEKSGAAHVGKKE
FT                   KSGAAHEGKKENALPLPGGGDEPPPRPTGNLTAPPAPPAPPRPVPALRDSSTAKSKKGA
FT                   GLGEERLPGSNGGVFGVLRGLMRRRETSEERAFRAWQKKHDTGEVGAATAARRLLAVPG
FT                   RDGRSKTTKSRSKDRGEGSKVPGWTCVIVGENARVAQKISRAVADVGLPCASVVNRANK
FT                   TRDGANVRGEECEVKRARAADVKLMSRARHVVATEHNDGAHVAALLRRCARDAA"
     MGGFSEYRRK KATMLSAAKR LRVEDRGGQE RRSARVGRGA EDGTVASDRG LPTRGWQVSV        60
     TEPVAGSRRG LSRPLVAGEP IMKKSDRREA TSDRRRAGGY GAADGAPIAW DAADDLPMHP       120
     RTRGRSSAAA SSSSAFPSCA ALVTGVALMM MVAVCALAVV HPELARAGAT HAAAAWTGRV       180
     SSFVSSFRRE TVDTQSARLA FLAPHGHDGR HRHAQKTAAK MGPGCELLSV EEAAASVAAA       240
     FAKGESSIGA ACEAAKQFRW DDVDPYVDAA AKDRVGGNED EGKVVVFHAG SRFDPDAVTR       300
     AAEMMARDDE VDPKVSPGEG SAGAEKRKEK SGAAHVGKKE KSGAAHEGKK ENALPLPGGG       360
     DEPPPRPTGN LTAPPAPPAP PRPVPALRDS STAKSKKGAG LGEERLPGSN GGVFGVLRGL       420
     MRRRETSEER AFRAWQKKHD TGEVGAATAA RRLLAVPGRD GRSKTTKSRS KDRGEGSKVP       480
     GWTCVIVGEN ARVAQKISRA VADVGLPCAS VVNRANKTRD GANVRGEECE VKRARAADVK       540
     LMSRARHVVA TEHNDGAHVA ALLRRCARDA A                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page