(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE425

MICSR_1.PE425        Location/Qualifiers
FT   CDS             join(complement(832753..832814),complement(829304..832625))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637343"
FT                   /orf_name="MICPUN_99502"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62233.1"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniParc:UPI000199AACB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V2"
FT                   /transl_table=1
FT                   /translation="MSSLVSQLTAKTPATGKRSSRRKLGGTVSIVGTDVNEEVVSRALP
FT                   AITPGTKAKPLRKPLGERTNGATTAKKTRGLDDDAVTGLTNALKTAAKAAKKKDGDIAS
FT                   KENGADYSEFADLPTDPLERGLALVRKGVEAMRTGGVDPKEALLKFAKKPKSGPNVREA
FT                   AATVVNRLLETLEAAADDKSDTSRELDYSGGSDDENNESEVVEAVGDDDEEVEEDDSED
FT                   VFATATNSPVKSISGASDSAGVAADDLSAALQGMTVTVEEGVMGCGDESCGSGPDGACD
FT                   PLECMRRAGGPFKMPAKLVKQPSTVSTARSSPPEEKDAPVVGEKEEDEDDEDEEEDANE
FT                   STAEESVLATDDDDEDDADEEDDDESVADTASVAGTDSQEESSMADLAAVEAAAEADAA
FT                   EGSPMMSPGPEVVDVSDLPDGTPLAEPVPDAPIVIDADDTDEECDDDDEVTSKATPPAM
FT                   NATVREKLDSSAEDDAADETGYQEDDDEMPVSARRTPGRRSRAVVDSSDEDEADDEKAS
FT                   SREGEEGEGSGESPSIGTPPAANTPPAQPVFNAPPPTTGRRSILRRIASNMKMRAQREA
FT                   REAAMRAPNFDDDAASSELSAAANAPAPALAATQPKAFPKSALKKSSKYAAAPAPEPEV
FT                   SEEASTAADAVTPARRRPQRRAVIESARKKALAWIDDEASDDGDDDDDEDEDEACSADD
FT                   DFVCDDDDVEYDSDASSNAIAEDMHARSGGVMPNVTPSPEVPKTVSRAPKSILKGRTPG
FT                   KTPGKGSRLTFGDDDVKHMTDSEGEGSSPEPDENDPRLPRTMVAKGTAQDPYGLDDLKT
FT                   PTPPRPLAEVLNEARTPSWAKTPNTAGRKTVGFGASFGNEPPPTHSKALAAALASAAKP
FT                   GKTLNYGKHKETIARALYNEFNADAFDGKLPAKLDISWNAKLLTTAGLTHYKKVTRSTG
FT                   LSEYSARIELSTKVLDCAEKLEATLLHEMCHAAAWLLDHQAKPPHGATFKKWAKQAMRT
FT                   YPDVSVDTCHSYEIFQPYRYRCTQQWCNTEYGRHSKSIDVEAKACGVCNGRLEYLGKFN
FT                   PDGSKAEEKPPTAFSLFVKEHFAATKERMPAGTPHKNIMKELSGLWKSGGGTTGKKTRG
FT                   GDDEALSPDALGESMRTLKL"
     MSSLVSQLTA KTPATGKRSS RRKLGGTVSI VGTDVNEEVV SRALPAITPG TKAKPLRKPL        60
     GERTNGATTA KKTRGLDDDA VTGLTNALKT AAKAAKKKDG DIASKENGAD YSEFADLPTD       120
     PLERGLALVR KGVEAMRTGG VDPKEALLKF AKKPKSGPNV REAAATVVNR LLETLEAAAD       180
     DKSDTSRELD YSGGSDDENN ESEVVEAVGD DDEEVEEDDS EDVFATATNS PVKSISGASD       240
     SAGVAADDLS AALQGMTVTV EEGVMGCGDE SCGSGPDGAC DPLECMRRAG GPFKMPAKLV       300
     KQPSTVSTAR SSPPEEKDAP VVGEKEEDED DEDEEEDANE STAEESVLAT DDDDEDDADE       360
     EDDDESVADT ASVAGTDSQE ESSMADLAAV EAAAEADAAE GSPMMSPGPE VVDVSDLPDG       420
     TPLAEPVPDA PIVIDADDTD EECDDDDEVT SKATPPAMNA TVREKLDSSA EDDAADETGY       480
     QEDDDEMPVS ARRTPGRRSR AVVDSSDEDE ADDEKASSRE GEEGEGSGES PSIGTPPAAN       540
     TPPAQPVFNA PPPTTGRRSI LRRIASNMKM RAQREAREAA MRAPNFDDDA ASSELSAAAN       600
     APAPALAATQ PKAFPKSALK KSSKYAAAPA PEPEVSEEAS TAADAVTPAR RRPQRRAVIE       660
     SARKKALAWI DDEASDDGDD DDDEDEDEAC SADDDFVCDD DDVEYDSDAS SNAIAEDMHA       720
     RSGGVMPNVT PSPEVPKTVS RAPKSILKGR TPGKTPGKGS RLTFGDDDVK HMTDSEGEGS       780
     SPEPDENDPR LPRTMVAKGT AQDPYGLDDL KTPTPPRPLA EVLNEARTPS WAKTPNTAGR       840
     KTVGFGASFG NEPPPTHSKA LAAALASAAK PGKTLNYGKH KETIARALYN EFNADAFDGK       900
     LPAKLDISWN AKLLTTAGLT HYKKVTRSTG LSEYSARIEL STKVLDCAEK LEATLLHEMC       960
     HAAAWLLDHQ AKPPHGATFK KWAKQAMRTY PDVSVDTCHS YEIFQPYRYR CTQQWCNTEY      1020
     GRHSKSIDVE AKACGVCNGR LEYLGKFNPD GSKAEEKPPT AFSLFVKEHF AATKERMPAG      1080
     TPHKNIMKEL SGLWKSGGGT TGKKTRGGDD EALSPDALGE SMRTLKL                    1127
//

If you have problems or comments...

PBIL Back to PBIL home page