(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE426

MICSR_1.PE426        Location/Qualifiers
FT   CDS             833109..833492
FT                   /codon_start=1
FT                   /gene_family="HOG000264350" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637344"
FT                   /orf_name="MICPUN_57007"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61805.1"
FT                   /db_xref="HOGENOM:HBG560203"
FT                   /db_xref="InterPro:IPR008560"
FT                   /db_xref="UniParc:UPI000199AACC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V3"
FT                   /transl_table=1
FT                   /translation="MSGVQLKAVQDLQAQLTKVMEELDHKVFRPQQKAAFQCSIKCTDL
FT                   RGPQEEMHACLAKCGEPIQRHEAAVMGELQEFQHRVQRCVQQCQDKQATTQDQGKFDKC
FT                   VSECAVFYQKELASLKPQLMKKR"
     MSGVQLKAVQ DLQAQLTKVM EELDHKVFRP QQKAAFQCSI KCTDLRGPQE EMHACLAKCG        60
     EPIQRHEAAV MGELQEFQHR VQRCVQQCQD KQATTQDQGK FDKCVSECAV FYQKELASLK       120
     PQLMKKR                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page