(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE427

MICSR_1.PE427        Location/Qualifiers
FT   CDS             complement(833646..834200)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637345"
FT                   /orf_name="MICPUN_107925"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62234.1"
FT                   /db_xref="InterPro:IPR019540"
FT                   /db_xref="UniParc:UPI000199AACD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V4"
FT                   /transl_table=1
FT                   /translation="MEAAVGQLRQLLGLSPSPPHADIDEPKLNIRSVPASSAGFATWEV
FT                   DVLVRRRAAAGHRAAMDSLDSLAAVVKAMPEMDVPKALAEAAGESLSESRLAREAAVDG
FT                   RLEDAAVHARNSHAHAESAFFHPQIISLLYFPQEYKLAVYIPLFLPTLFPLFTGLMWDV
FT                   KFYVRRTRCAAEHRRRAGKAD"
     MEAAVGQLRQ LLGLSPSPPH ADIDEPKLNI RSVPASSAGF ATWEVDVLVR RRAAAGHRAA        60
     MDSLDSLAAV VKAMPEMDVP KALAEAAGES LSESRLAREA AVDGRLEDAA VHARNSHAHA       120
     ESAFFHPQII SLLYFPQEYK LAVYIPLFLP TLFPLFTGLM WDVKFYVRRT RCAAEHRRRA       180
     GKAD                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page