(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE428

MICSR_1.PE428        Location/Qualifiers
FT   CDS             836124..837818
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637346"
FT                   /orf_name="MICPUN_57009"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61806.1"
FT                   /db_xref="UniParc:UPI000199AACE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V5"
FT                   /transl_table=1
FT                   /translation="MSQSNTGAGYDEFTPVPLTAEALAQLASQDHGLGNVARMMDNGVW
FT                   NTDGVQDDIRRESIDRDVDRYHRTLDMGKRVPRNSRRSEDAEPRISCNSNLSGFDAVGG
FT                   SFIAHLAPRYGSSSFTSRATSLAMNAIAAELDCTEVRAVSTRGSVAHETAGVQAFHSDV
FT                   ISALFVGHLDNKLDLARKCDVPTGISCAELVFHLYNDCGAAFLDQLQGFFAFCIVDAGS
FT                   ATVFAAVDRHASIPLYKARSKGGGVFIAHPGGSGSSAIKLSTLGEMSKIPAGSYVHGNR
FT                   HINPHKYARDKFAERALMEMDTLDETASVLSAGPSPFDIMDQNKTGQPAGFSSLFSSGS
FT                   LFSQSMDDLPSMEGGYPERRETTSPPKVKDVLRRRHSVEDLTKFSDGIGTWNARWNMDE
FT                   DDDDMNVVQVDGHGSESRMGESFHRARKNGSAVSNVSGLDTAPGTPSKADVGTFGKPPA
FT                   VPDERRRHVAHVEKKSSPARTRVRKSSWSNGSEEEARGKENMRRVHSDGELNSLSGRSN
FT                   PKAIPSRAKDDASVISMCRSMSTGHVSSSDALSETECYVSLSLGAGA"
     MSQSNTGAGY DEFTPVPLTA EALAQLASQD HGLGNVARMM DNGVWNTDGV QDDIRRESID        60
     RDVDRYHRTL DMGKRVPRNS RRSEDAEPRI SCNSNLSGFD AVGGSFIAHL APRYGSSSFT       120
     SRATSLAMNA IAAELDCTEV RAVSTRGSVA HETAGVQAFH SDVISALFVG HLDNKLDLAR       180
     KCDVPTGISC AELVFHLYND CGAAFLDQLQ GFFAFCIVDA GSATVFAAVD RHASIPLYKA       240
     RSKGGGVFIA HPGGSGSSAI KLSTLGEMSK IPAGSYVHGN RHINPHKYAR DKFAERALME       300
     MDTLDETASV LSAGPSPFDI MDQNKTGQPA GFSSLFSSGS LFSQSMDDLP SMEGGYPERR       360
     ETTSPPKVKD VLRRRHSVED LTKFSDGIGT WNARWNMDED DDDMNVVQVD GHGSESRMGE       420
     SFHRARKNGS AVSNVSGLDT APGTPSKADV GTFGKPPAVP DERRRHVAHV EKKSSPARTR       480
     VRKSSWSNGS EEEARGKENM RRVHSDGELN SLSGRSNPKA IPSRAKDDAS VISMCRSMST       540
     GHVSSSDALS ETECYVSLSL GAGA                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page