(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE429

MICSR_1.PE429        Location/Qualifiers
FT   CDS             838324..840309
FT                   /codon_start=1
FT                   /gene_family="HOG000258608" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637347"
FT                   /orf_name="MICPUN_57010"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61807.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG315546"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199AACF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V6"
FT                   /transl_table=1
FT                   /translation="MAGAVTGIPEGRATETIYGLIRDGKHDECAKLLEIQLANAPDSRP
FT                   ALSLLGYCYYYLGNFERAAEMYGQLAKLFPENEDYAVHHAQSLYKASMYQDALRASRAI
FT                   DSKDPAVRQKVSQLQALIAYEEDDLAGCRARLDECPSDDPDVVVNLACCMLKEGRFEEA
FT                   RTRFLDAQQALGFQADIAYNIALCYYRTKQFGPALKHLAEIIERGMREHPELAVGAATD
FT                   ATQTGEEIRSVGNTPALKETALVEAFNLKAAIEYAMGNSEGFREALTDMPPRTEEELDP
FT                   VTLHNVALMNMESDPTDGFHKLNFLLQSPVSPPETFGNLLLLYCKPEHGFYDLAADVMA
FT                   ENPQLVAKHLPQEVHQFLEATILAQTAPEEAYRKFEELVQRNADKLRRLTRKIQEYRQG
FT                   RDDKALKKSLAEYDETLDAYVPALMAQAKIYWDAENYQQVEKILRQGADYCADHEAYKV
FT                   NMAHTCFMQALSNDEKYVDAIQHYEPIVREKLEDESGMGVLNVTAIVLANLCVAYIMTS
FT                   QNEEAEELMRAIERAEEEVQYHDPNRQCFHLCIVNLVIGTLYCSKGNYEFGISRVIKSL
FT                   EPYDKKLETDTWFYAKRCVVALLDLLGKHMITVPDSTMDEVMAFLDEAERHGREIVTQL
FT                   GDDGQGRTLTTEARMIKKMFIKLRDL"
     MAGAVTGIPE GRATETIYGL IRDGKHDECA KLLEIQLANA PDSRPALSLL GYCYYYLGNF        60
     ERAAEMYGQL AKLFPENEDY AVHHAQSLYK ASMYQDALRA SRAIDSKDPA VRQKVSQLQA       120
     LIAYEEDDLA GCRARLDECP SDDPDVVVNL ACCMLKEGRF EEARTRFLDA QQALGFQADI       180
     AYNIALCYYR TKQFGPALKH LAEIIERGMR EHPELAVGAA TDATQTGEEI RSVGNTPALK       240
     ETALVEAFNL KAAIEYAMGN SEGFREALTD MPPRTEEELD PVTLHNVALM NMESDPTDGF       300
     HKLNFLLQSP VSPPETFGNL LLLYCKPEHG FYDLAADVMA ENPQLVAKHL PQEVHQFLEA       360
     TILAQTAPEE AYRKFEELVQ RNADKLRRLT RKIQEYRQGR DDKALKKSLA EYDETLDAYV       420
     PALMAQAKIY WDAENYQQVE KILRQGADYC ADHEAYKVNM AHTCFMQALS NDEKYVDAIQ       480
     HYEPIVREKL EDESGMGVLN VTAIVLANLC VAYIMTSQNE EAEELMRAIE RAEEEVQYHD       540
     PNRQCFHLCI VNLVIGTLYC SKGNYEFGIS RVIKSLEPYD KKLETDTWFY AKRCVVALLD       600
     LLGKHMITVP DSTMDEVMAF LDEAERHGRE IVTQLGDDGQ GRTLTTEARM IKKMFIKLRD       660
     L                                                                       661
//

If you have problems or comments...

PBIL Back to PBIL home page