(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE43

MICSR_1.PE43         Location/Qualifiers
FT   CDS             complement(83764..84849)
FT                   /codon_start=1
FT                   /gene_family="HOG000172217" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636048"
FT                   /orf_name="MICPUN_99249"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="ACO62050.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG714097"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AB32"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S0"
FT                   /transl_table=1
FT                   /translation="MAADPTAAGPGGLSEEQAAVYDRQLRVWGVEAQRRLGASRILVAG
FT                   LTGLAAEACKNVALAGVGALVLYDDGAPAVDAAPGNFLAASGLADAAGTADADALTVAN
FT                   ATAATLREMNPFGEISILPGPSDLSGIDAAAVKGCDAVLVTGCSLAVAERINDACRDAG
FT                   ASFFYGECRATVANFFADLGPNFRYAVERGRSNTAEKDGDAANNAGADAAVVSSFVPLR
FT                   EAVTCKWCTLGDGREGGVRRVNRLAPAWLLSKRFERSLKRPPSAQDVPTMLAEVPALEK
FT                   EHGVKPGWLGDARWAVEDVVAGASGVGDGGESPAVAAVVGGILAQEVLRSVTGKGEPVR
FT                   NSFFFGVRNGQGTVENMGCPT"
     MAADPTAAGP GGLSEEQAAV YDRQLRVWGV EAQRRLGASR ILVAGLTGLA AEACKNVALA        60
     GVGALVLYDD GAPAVDAAPG NFLAASGLAD AAGTADADAL TVANATAATL REMNPFGEIS       120
     ILPGPSDLSG IDAAAVKGCD AVLVTGCSLA VAERINDACR DAGASFFYGE CRATVANFFA       180
     DLGPNFRYAV ERGRSNTAEK DGDAANNAGA DAAVVSSFVP LREAVTCKWC TLGDGREGGV       240
     RRVNRLAPAW LLSKRFERSL KRPPSAQDVP TMLAEVPALE KEHGVKPGWL GDARWAVEDV       300
     VAGASGVGDG GESPAVAAVV GGILAQEVLR SVTGKGEPVR NSFFFGVRNG QGTVENMGCP       360
     T                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page