(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE430

MICSR_1.PE430        Location/Qualifiers
FT   CDS             complement(<840761..>842197)
FT                   /codon_start=1
FT                   /gene_family="HOG000175620" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637348"
FT                   /orf_name="MICPUN_67015"
FT                   /product="Predicted protein"
FT                   /function="gamma-glutamyltransferase activity"
FT                   /protein_id="ACO62235.1"
FT                   /db_xref="GO:0003840"
FT                   /db_xref="HOGENOM:HBG738311"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="UniParc:UPI000199AAD0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V7"
FT                   /transl_table=1
FT                   /translation="GAVAADEARCSAIGAAVLDDGGHAVDASIATALCLGVTHPHSSGV
FT                   GGGAFMVIRLANGTTEAIEFRESAPAAAYRDMYVDGSGANGANRSSTFGGAAVAVPAEL
FT                   AGLHLAWERHGRLPWRRLVEPAALLANGFEVGKDLAREIADMAEDLAKFPVTKEVFLKA
FT                   DGSPLLEGETCANTRLAATLRRVANEGPSVLRTGELADALAKDIRDAGGVMESSDLAAY
FT                   RPRIFEPIVASAMGVELIGMPPPSSGGAAVAQIIEFLDGYDLPLASAGTLGTHRTAEAF
FT                   KHAFAMRMNLGDPDSATPDMTAALNDMLSPTFNAELRSMTKDDRTLNVTAYGAKWNQLD
FT                   DSGTTHVSVVDKERNAVALTSTINTEFGSKLVSPSTGIVLNNEMDDFSSPGEVNHYGLA
FT                   PHEANFIAAGKRPLSSMSPTIVTRDGKLYAVAGASGGPRIITATAQLLLNVIARGMSPL
FT                   DAVNAPRLHHQLVPHVAFAEN"
     GAVAADEARC SAIGAAVLDD GGHAVDASIA TALCLGVTHP HSSGVGGGAF MVIRLANGTT        60
     EAIEFRESAP AAAYRDMYVD GSGANGANRS STFGGAAVAV PAELAGLHLA WERHGRLPWR       120
     RLVEPAALLA NGFEVGKDLA REIADMAEDL AKFPVTKEVF LKADGSPLLE GETCANTRLA       180
     ATLRRVANEG PSVLRTGELA DALAKDIRDA GGVMESSDLA AYRPRIFEPI VASAMGVELI       240
     GMPPPSSGGA AVAQIIEFLD GYDLPLASAG TLGTHRTAEA FKHAFAMRMN LGDPDSATPD       300
     MTAALNDMLS PTFNAELRSM TKDDRTLNVT AYGAKWNQLD DSGTTHVSVV DKERNAVALT       360
     STINTEFGSK LVSPSTGIVL NNEMDDFSSP GEVNHYGLAP HEANFIAAGK RPLSSMSPTI       420
     VTRDGKLYAV AGASGGPRII TATAQLLLNV IARGMSPLDA VNAPRLHHQL VPHVAFAEN        479
//

If you have problems or comments...

PBIL Back to PBIL home page