(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE431

MICSR_1.PE431        Location/Qualifiers
FT   CDS             join(842783..842881,842993..843400)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637349"
FT                   /orf_name="MICPUN_57012"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61808.1"
FT                   /db_xref="UniParc:UPI000199AAD1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V8"
FT                   /transl_table=1
FT                   /translation="MTGWTPIELPPSNPKRTLDIVPKGLEAQEVCELMFKAIETNDCDT
FT                   YLSCCSHSTRAPRTVGSFGLTNWDQGREQWRKYKVTYRFLGESDPDDDDERPPGEWLKG
FT                   AERLVCRYQGQFGKVPGYDHGETVPRPAQAKQRPEQDVAVHLIREPLGGIWGAEREWRV
FT                   FKVEY"
     MTGWTPIELP PSNPKRTLDI VPKGLEAQEV CELMFKAIET NDCDTYLSCC SHSTRAPRTV        60
     GSFGLTNWDQ GREQWRKYKV TYRFLGESDP DDDDERPPGE WLKGAERLVC RYQGQFGKVP       120
     GYDHGETVPR PAQAKQRPEQ DVAVHLIREP LGGIWGAERE WRVFKVEY                    168
//

If you have problems or comments...

PBIL Back to PBIL home page