(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE432

MICSR_1.PE432        Location/Qualifiers
FT   CDS             complement(843511..845583)
FT                   /codon_start=1
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637350"
FT                   /orf_name="MICPUN_80126"
FT                   /product="Predicted protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="acyl-CoA oxidase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="fatty acid beta-oxidation "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="ACO62236.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0003997"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0006635"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG737904"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000199AAD2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V9"
FT                   /transl_table=1
FT                   /translation="MITAHQADPTEDLRRERSQASFPSRELAALMAGGEAQLKLRERIA
FT                   DAVRADPVFSKKGKYFMERADLYRTTLEKYLALPRLATAIDPNDPITVGKIIRELIDEP
FT                   GGLDLHLGMFIPTIQGQGDEEQRKHWLPMCTKLQIIGTYAQTELGHGTYIRGLETTATY
FT                   DAEKEQFIIHSPTLTATKWWPGGMGKTSTHAVVMARLITHGRDRGPHAFVVQIRRNEDH
FT                   QTMPGVTAGDIGPKMGYNAVDNGFLRFDHVRVPRRAMLMRYSKVDPDGTFHPPPVAKAS
FT                   YGTMVFVRSDIVMNAALYMKKAVTIAMRYNLVRRQSNPGGEKASGGVGQKGLELQVIDY
FT                   QHSQRSLFPILARAFAFHCTSDFMRRMYFRYEKVSTRKGDFSALPELHATSSGLKAYCS
FT                   WATKDAIELCRLCCGGHGFMMLAGFGTTFGNYAPNATYEGDNNVLCLQTARYLLKVARA
FT                   VAKAAARGGDVRDAEEGAQGTSAYILEGGGGLEPGCQLGKSVGLRDTEAALGAFAHAAR
FT                   RQILAAASRAGTLGADAAMSRDMVAWIKAAKAHCAYVVLLNFVDAVAESKPRVSSATAA
FT                   VMDRLVSLHALATMDDNMGDFLEDGHVSADQAAAIRAEVAVLLAELRPDAAALVDSFAL
FT                   DDYFLNSALGSHDGDVYRRLYDEVQSAPFNASHVPPGYADLLHSRLIKGAGRSRL"
     MITAHQADPT EDLRRERSQA SFPSRELAAL MAGGEAQLKL RERIADAVRA DPVFSKKGKY        60
     FMERADLYRT TLEKYLALPR LATAIDPNDP ITVGKIIREL IDEPGGLDLH LGMFIPTIQG       120
     QGDEEQRKHW LPMCTKLQII GTYAQTELGH GTYIRGLETT ATYDAEKEQF IIHSPTLTAT       180
     KWWPGGMGKT STHAVVMARL ITHGRDRGPH AFVVQIRRNE DHQTMPGVTA GDIGPKMGYN       240
     AVDNGFLRFD HVRVPRRAML MRYSKVDPDG TFHPPPVAKA SYGTMVFVRS DIVMNAALYM       300
     KKAVTIAMRY NLVRRQSNPG GEKASGGVGQ KGLELQVIDY QHSQRSLFPI LARAFAFHCT       360
     SDFMRRMYFR YEKVSTRKGD FSALPELHAT SSGLKAYCSW ATKDAIELCR LCCGGHGFMM       420
     LAGFGTTFGN YAPNATYEGD NNVLCLQTAR YLLKVARAVA KAAARGGDVR DAEEGAQGTS       480
     AYILEGGGGL EPGCQLGKSV GLRDTEAALG AFAHAARRQI LAAASRAGTL GADAAMSRDM       540
     VAWIKAAKAH CAYVVLLNFV DAVAESKPRV SSATAAVMDR LVSLHALATM DDNMGDFLED       600
     GHVSADQAAA IRAEVAVLLA ELRPDAAALV DSFALDDYFL NSALGSHDGD VYRRLYDEVQ       660
     SAPFNASHVP PGYADLLHSR LIKGAGRSRL                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page