(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE433

MICSR_1.PE433        Location/Qualifiers
FT   CDS             845975..847522
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637351"
FT                   /orf_name="MICPUN_57014"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61809.1"
FT                   /db_xref="UniParc:UPI000199AAD3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W0"
FT                   /transl_table=1
FT                   /translation="MGAESKGILKPSRFSAHVDEPAAHADEGDATPSATQTTHYKEFHS
FT                   RVADVFANLGPGICGSGSTGGASDPKGSHQSPAEAVWMPANTTVTRRGARDDYSDDDDD
FT                   DEDEDGRIGRPKRNGNDDSSDDSRDDPSDEDDEEDRPTFDHTASNAEVSEVRRQRQKAR
FT                   WAEDLDCLESDEEGDDDQKKMAKLGRSVGRCSALNDEEEFDCYDTLAMTGMNRRQPMDR
FT                   NGEGGIDVARIRRLVEGDDDEFEEVDKEDVGFTKVLASNEYERRILAREGKDAPDEDED
FT                   EDEDEDEDEDTPDEAAAAAAGVGAATVDPVADGAAAAGRRKRGGFGGAYVPPNKRAKGE
FT                   PGAAPTRGVAWDDSVPEVTRPRFGGSRGRGGGRGRGRGVPDHVKNPHKYTCYTLDEPLT
FT                   VGGGGGVGDGFKEMEAARRAASAAAAARDATPNERSLPAAPTEKPVFQLSAAAAARRDA
FT                   RRGEKKKAGSATVAGVKIDFAHDDEDDEGGAEDGNRSGLGGSKKRARNFRKKAAEDD"
     MGAESKGILK PSRFSAHVDE PAAHADEGDA TPSATQTTHY KEFHSRVADV FANLGPGICG        60
     SGSTGGASDP KGSHQSPAEA VWMPANTTVT RRGARDDYSD DDDDDEDEDG RIGRPKRNGN       120
     DDSSDDSRDD PSDEDDEEDR PTFDHTASNA EVSEVRRQRQ KARWAEDLDC LESDEEGDDD       180
     QKKMAKLGRS VGRCSALNDE EEFDCYDTLA MTGMNRRQPM DRNGEGGIDV ARIRRLVEGD       240
     DDEFEEVDKE DVGFTKVLAS NEYERRILAR EGKDAPDEDE DEDEDEDEDE DTPDEAAAAA       300
     AGVGAATVDP VADGAAAAGR RKRGGFGGAY VPPNKRAKGE PGAAPTRGVA WDDSVPEVTR       360
     PRFGGSRGRG GGRGRGRGVP DHVKNPHKYT CYTLDEPLTV GGGGGVGDGF KEMEAARRAA       420
     SAAAAARDAT PNERSLPAAP TEKPVFQLSA AAAARRDARR GEKKKAGSAT VAGVKIDFAH       480
     DDEDDEGGAE DGNRSGLGGS KKRARNFRKK AAEDD                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page