(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE434

MICSR_1.PE434        Location/Qualifiers
FT   CDS             join(847817..848164,848264..848350)
FT                   /codon_start=1
FT                   /gene_family="HOG000030633" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637352"
FT                   /orf_name="MICPUN_57015"
FT                   /product="Twin arginine targeting family "
FT                   /function="protein transporter activity"
FT                   /biological_process="protein secretion"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ACO61810.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0009306"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR003998"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniParc:UPI000199AAD4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W1"
FT                   /transl_table=1
FT                   /translation="MASTTASLVVRPTHAVRTRARSPASSAAPKSAAMSGLSAPAPAFL
FT                   GAKPAQLSAGITAGRSGAGTRSVATMGLFGLGLPELVVIGGVAAVLFGPSKLPELGKSL
FT                   GKTVKSFQAAANEFQDELKSDKEGEEQPPKQIEEGEKKSD"
     MASTTASLVV RPTHAVRTRA RSPASSAAPK SAAMSGLSAP APAFLGAKPA QLSAGITAGR        60
     SGAGTRSVAT MGLFGLGLPE LVVIGGVAAV LFGPSKLPEL GKSLGKTVKS FQAAANEFQD       120
     ELKSDKEGEE QPPKQIEEGE KKSD                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page