(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE435

MICSR_1.PE435        Location/Qualifiers
FT   CDS             complement(848405..850036)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637353"
FT                   /orf_name="MICPUN_57016"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62237.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AAD5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W2"
FT                   /transl_table=1
FT                   /translation="MGIFDEVFGRKIEGDGGGLFSDKYKAERDVIHDPLPASAYVDVLK
FT                   KNDELLEQLAKSGKGMAREEFSDSDGDSDGYSDKDDSSDSDSDSERPAKKPKKKERSKY
FT                   EEMDEAFAEANAMMAEGEPDKRKKSAAAAAEDTSDDESGSEEDDESDSDAGSDDEDDEG
FT                   AGASSDSDSLTDVEAERAARKAARDEAKAKKAAAKQAKEQQPGEEHRPQDDALPRTVFV
FT                   GNLPVTIKPKKLKTLFSEFGAVDSVRLRNVPVDPEGKMPRGGKVITGKLVENRKSTNAY
FT                   VVFKEEKSVEAACKGMNMREVDGRHVRVDRAVAPSAKANETIAKEKGANAGGEVAYDHT
FT                   RSLFLGNLPYDVDEEDVIRLFHRSKEYPELNGAVEAVRVVRDRKTNLGKGIAFVLFRKG
FT                   SDARTGLLLDGTKMGEREVRVTRASKNREALKAQAEKSKKRKADKEAKKEPQGAARRLG
FT                   LDKAPDAKGSAAAWEGSRSRPGGKRQKIAFGGYDAAIERGKDGKKGAGGKGGGKPAAKG
FT                   ARTGKRPAVAARKAKAKAQAAAGKKK"
     MGIFDEVFGR KIEGDGGGLF SDKYKAERDV IHDPLPASAY VDVLKKNDEL LEQLAKSGKG        60
     MAREEFSDSD GDSDGYSDKD DSSDSDSDSE RPAKKPKKKE RSKYEEMDEA FAEANAMMAE       120
     GEPDKRKKSA AAAAEDTSDD ESGSEEDDES DSDAGSDDED DEGAGASSDS DSLTDVEAER       180
     AARKAARDEA KAKKAAAKQA KEQQPGEEHR PQDDALPRTV FVGNLPVTIK PKKLKTLFSE       240
     FGAVDSVRLR NVPVDPEGKM PRGGKVITGK LVENRKSTNA YVVFKEEKSV EAACKGMNMR       300
     EVDGRHVRVD RAVAPSAKAN ETIAKEKGAN AGGEVAYDHT RSLFLGNLPY DVDEEDVIRL       360
     FHRSKEYPEL NGAVEAVRVV RDRKTNLGKG IAFVLFRKGS DARTGLLLDG TKMGEREVRV       420
     TRASKNREAL KAQAEKSKKR KADKEAKKEP QGAARRLGLD KAPDAKGSAA AWEGSRSRPG       480
     GKRQKIAFGG YDAAIERGKD GKKGAGGKGG GKPAAKGART GKRPAVAARK AKAKAQAAAG       540
     KKK                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page