(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE436

MICSR_1.PE436        Location/Qualifiers
FT   CDS             join(852218..852403,852500..>853299)
FT                   /codon_start=1
FT                   /gene_family="HOG000197973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637354"
FT                   /orf_name="MICPUN_80108"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO61811.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG714073"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199AAD6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W3"
FT                   /transl_table=1
FT                   /translation="MPGGLLHLDNSEHILSIGYVHRHRPFEEEYDLGEAIGTGGFAVVR
FT                   KAVHRATGVTYAVKTLRKPRKLVAMSLEEVMNELIMMQQLSEHPSIITIKEFFTEGGAD
FT                   YDHIATKPTTGLDEEEDGIVHVVMELLEGQELVDAITDVGAYDEGQSQIVMSSMLDAIA
FT                   FMHARGVVHRDLKLENLCLAKPNDLNSVTLLDFGLAKALTAREKEENVCGTLAYVAPEA
FT                   LVAGVYGQGVDVWALGVAMHVLLTGAWPFDDDDEDELIDQIVECDLDFDEGEEWQAISP
FT                   QAKDLLGGLLEPNPKRRLGAAQALEHAWFTGQKNNTSERLHHVHARL"
     MPGGLLHLDN SEHILSIGYV HRHRPFEEEY DLGEAIGTGG FAVVRKAVHR ATGVTYAVKT        60
     LRKPRKLVAM SLEEVMNELI MMQQLSEHPS IITIKEFFTE GGADYDHIAT KPTTGLDEEE       120
     DGIVHVVMEL LEGQELVDAI TDVGAYDEGQ SQIVMSSMLD AIAFMHARGV VHRDLKLENL       180
     CLAKPNDLNS VTLLDFGLAK ALTAREKEEN VCGTLAYVAP EALVAGVYGQ GVDVWALGVA       240
     MHVLLTGAWP FDDDDEDELI DQIVECDLDF DEGEEWQAIS PQAKDLLGGL LEPNPKRRLG       300
     AAQALEHAWF TGQKNNTSER LHHVHARL                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page