(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE437

MICSR_1.PE437        Location/Qualifiers
FT   CDS             855288..856454
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637355"
FT                   /orf_name="MICPUN_52253"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61812.1"
FT                   /db_xref="UniParc:UPI000199AAD7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W4"
FT                   /transl_table=1
FT                   /translation="MNRDEKQSALPLPTSSNHIPALRALAESDALSPSLLILSDAARTL
FT                   SRGAFLYLNLASHSLVHLEIRNCEWLESLDFVSELPSLRCLSLRGCVALPSHSLEALAR
FT                   PPKNDDAHAPPRRRGRRRPELAGNRAGARDPPNLVSLDLSGCAAVDDAAGPHLARLPRS
FT                   MRSLDLSTCAVGNLLLDYLTYRGRLTRWRRDRRGIGESENGTSEDGTSDDDGCTATDLR
FT                   LRGTRVSDAGLGHLKTLGPDVALLDLSECRGVSAGAIAELASVLGMSASTSRPGLLVAP
FT                   GTGEGREMCACGSGRESCCELAEEGWRAFLCAVREEEIREEEIREEEIREESQRVAALA
FT                   ASERDESDAVEDDGNIPMFPIGAPLSHSHPSGGESPPHQYRRVSYLID"
     MNRDEKQSAL PLPTSSNHIP ALRALAESDA LSPSLLILSD AARTLSRGAF LYLNLASHSL        60
     VHLEIRNCEW LESLDFVSEL PSLRCLSLRG CVALPSHSLE ALARPPKNDD AHAPPRRRGR       120
     RRPELAGNRA GARDPPNLVS LDLSGCAAVD DAAGPHLARL PRSMRSLDLS TCAVGNLLLD       180
     YLTYRGRLTR WRRDRRGIGE SENGTSEDGT SDDDGCTATD LRLRGTRVSD AGLGHLKTLG       240
     PDVALLDLSE CRGVSAGAIA ELASVLGMSA STSRPGLLVA PGTGEGREMC ACGSGRESCC       300
     ELAEEGWRAF LCAVREEEIR EEEIREEEIR EESQRVAALA ASERDESDAV EDDGNIPMFP       360
     IGAPLSHSHP SGGESPPHQY RRVSYLID                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page