(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE438

MICSR_1.PE438        Location/Qualifiers
FT   CDS             join(complement(857318..859397),complement(856504..857033))
FT                   /codon_start=1
FT                   /gene_family="HOG000100027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637356"
FT                   /orf_name="MICPUN_57020"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62238.1"
FT                   /db_xref="HOGENOM:HBG608405"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199AB45"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W5"
FT                   /transl_table=1
FT                   /translation="MSSRQVQLNQELARKTLAADVLAIVRDSVDEFNLVNCGTALQRLA
FT                   KCPDTHRLLSPTSSALPGVPRVLQEQFARLLDAAARLVSKDPRHVESRQLASMLWACGK
FT                   LELGHRAADLVEGIETAAIMHASKFNPQELANAIWGAAKLGLDPSRSELVRAVADAIAV
FT                   SLPRASAAPGGPQRNPKGAGPGGWRANAPREWTPQGISNVAMSLAKLDADVTHGEGVST
FT                   TGGGFKYGRVFGEVCAAAKARAEDFNPQEIANILHALAKLTAGDGDGDGGGRTIVGPVE
FT                   RTARDATEALASRITRRWIEAQRLEPQHVANMSWACAKMGAAGGDDLAGALATAAATLA
FT                   PRMNTQELSMCAWSAAAFGSGRWPADCAETVARAFGNRAGEATPRQLAKAAMAYAKLGT
FT                   LHPRLMDAVANAVLALEQPFASALNPQDVANLAWSFSKLGFKKKRLFDAISAAFVAHLG
FT                   EDEARFSSQQLTMIVCAFGLLDFKDESMLNAAMGAMSKERVAEFNPRDLTNTSWALAAL
FT                   GVNAEAKPDLVERIGRTARKRLDDFNSQELLKFLGAFERLGGKDSKLAKAVSKQRTLSY
FT                   EFPALSTHAESSFVKLSSKTPTSYQGTDRVRVDDSCGGWGRGNTGVALWEGSFVLAEWL
FT                   SRQSTPTGSDEMAEVMRGAWGPNESGGWRGMTGVELGAGLGLPSIVASKLGLEMVATDG
FT                   DDDVLELLSQNIETNTSPEAKARVSRLVWGCDEPLEHLGLSEPPKLILASDVVYGNDPQ
FT                   KWKLLVKTMCDLSGPSTLVVIGNVQRYPVHHPMAETKFFSEATARDFERTEVPVTSLHP
FT                   DFRRTGGGACVIHLFRRRPESLKRSRSDSDVSERKVKKSKKEKKGKKEKKSSKKERK"
     MSSRQVQLNQ ELARKTLAAD VLAIVRDSVD EFNLVNCGTA LQRLAKCPDT HRLLSPTSSA        60
     LPGVPRVLQE QFARLLDAAA RLVSKDPRHV ESRQLASMLW ACGKLELGHR AADLVEGIET       120
     AAIMHASKFN PQELANAIWG AAKLGLDPSR SELVRAVADA IAVSLPRASA APGGPQRNPK       180
     GAGPGGWRAN APREWTPQGI SNVAMSLAKL DADVTHGEGV STTGGGFKYG RVFGEVCAAA       240
     KARAEDFNPQ EIANILHALA KLTAGDGDGD GGGRTIVGPV ERTARDATEA LASRITRRWI       300
     EAQRLEPQHV ANMSWACAKM GAAGGDDLAG ALATAAATLA PRMNTQELSM CAWSAAAFGS       360
     GRWPADCAET VARAFGNRAG EATPRQLAKA AMAYAKLGTL HPRLMDAVAN AVLALEQPFA       420
     SALNPQDVAN LAWSFSKLGF KKKRLFDAIS AAFVAHLGED EARFSSQQLT MIVCAFGLLD       480
     FKDESMLNAA MGAMSKERVA EFNPRDLTNT SWALAALGVN AEAKPDLVER IGRTARKRLD       540
     DFNSQELLKF LGAFERLGGK DSKLAKAVSK QRTLSYEFPA LSTHAESSFV KLSSKTPTSY       600
     QGTDRVRVDD SCGGWGRGNT GVALWEGSFV LAEWLSRQST PTGSDEMAEV MRGAWGPNES       660
     GGWRGMTGVE LGAGLGLPSI VASKLGLEMV ATDGDDDVLE LLSQNIETNT SPEAKARVSR       720
     LVWGCDEPLE HLGLSEPPKL ILASDVVYGN DPQKWKLLVK TMCDLSGPST LVVIGNVQRY       780
     PVHHPMAETK FFSEATARDF ERTEVPVTSL HPDFRRTGGG ACVIHLFRRR PESLKRSRSD       840
     SDVSERKVKK SKKEKKGKKE KKSSKKERK                                         869
//

If you have problems or comments...

PBIL Back to PBIL home page