(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE439

MICSR_1.PE439        Location/Qualifiers
FT   CDS             complement(859804..861807)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637357"
FT                   /orf_name="MICPUN_57021"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62239.1"
FT                   /db_xref="HOGENOM:HBG560211"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniParc:UPI000199AB46"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W6"
FT                   /transl_table=1
FT                   /translation="MAQQQPPPLILFLAGAAAGALIAANGVLSAVRKRAGRSRSRDDGR
FT                   RVRVGLEVAKDDNWKIFRGKKVGVVSNPTGVLPTTLEHTVDVMHASVGTVDIRAVFGPE
FT                   QGFRGVGQNSNPYGSYDSDKENGSDGSFVDQRTGLPVYDTYLKKGPELTAILERSGVDV
FT                   VAFDIQDVGARYYAYVWTLYDVMVAAASAKKPISVVVLDRPNPLGGEVLEGPVDIAVGC
FT                   ESLVGRKPIPVRHGMTVGELAWFLNKKYVAADPDNGSRKSVKLSVVAMRGYRRRMTWEE
FT                   TGLPWVPPSPNMPTPRTALAYVGGALLEGTNCCEGKGTTAPFELVGATWADGRLADFLM
FT                   RRTPASAARSVAPLDASNESPQPRSEEEETEPAPSRRGRSSVKRGLNYRPNYAESSPGN
FT                   SPRKNGARPSPGTPRGGIGKKPRGGKSAKGKGRKKSKSRLSRPPSGKMIRIREGAPVDG
FT                   PAAKYREAYFTPTSGALQGRIVSGVQVYPRGIENALFREGVEILLALRRCYPGEFAWRE
FT                   QATVRARVENARWRAENSAVLRSPAKSTYSNYSRKGGYYPDERSSDDGYSSEDDRGWRG
FT                   DDGEVPWSPESARRPGRRPGLPPRSPVPPAPPPPARWDPKKTPFIDMLTGSAALREAVD
FT                   AADDEKVEGVIAEWESQLEKFAEVRRGFLLYD"
     MAQQQPPPLI LFLAGAAAGA LIAANGVLSA VRKRAGRSRS RDDGRRVRVG LEVAKDDNWK        60
     IFRGKKVGVV SNPTGVLPTT LEHTVDVMHA SVGTVDIRAV FGPEQGFRGV GQNSNPYGSY       120
     DSDKENGSDG SFVDQRTGLP VYDTYLKKGP ELTAILERSG VDVVAFDIQD VGARYYAYVW       180
     TLYDVMVAAA SAKKPISVVV LDRPNPLGGE VLEGPVDIAV GCESLVGRKP IPVRHGMTVG       240
     ELAWFLNKKY VAADPDNGSR KSVKLSVVAM RGYRRRMTWE ETGLPWVPPS PNMPTPRTAL       300
     AYVGGALLEG TNCCEGKGTT APFELVGATW ADGRLADFLM RRTPASAARS VAPLDASNES       360
     PQPRSEEEET EPAPSRRGRS SVKRGLNYRP NYAESSPGNS PRKNGARPSP GTPRGGIGKK       420
     PRGGKSAKGK GRKKSKSRLS RPPSGKMIRI REGAPVDGPA AKYREAYFTP TSGALQGRIV       480
     SGVQVYPRGI ENALFREGVE ILLALRRCYP GEFAWREQAT VRARVENARW RAENSAVLRS       540
     PAKSTYSNYS RKGGYYPDER SSDDGYSSED DRGWRGDDGE VPWSPESARR PGRRPGLPPR       600
     SPVPPAPPPP ARWDPKKTPF IDMLTGSAAL REAVDAADDE KVEGVIAEWE SQLEKFAEVR       660
     RGFLLYD                                                                 667
//

If you have problems or comments...

PBIL Back to PBIL home page