(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE44

MICSR_1.PE44         Location/Qualifiers
FT   CDS             complement(85104..87209)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636049"
FT                   /orf_name="MICPUN_56617"
FT                   /product="Set domain protein"
FT                   /protein_id="ACO62051.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199AB33"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S1"
FT                   /transl_table=1
FT                   /translation="MGSSGEDGSKLELGKIVEVSGKGLGIVATRDAVAGEVVAREQGPM
FT                   AISLSRDQLGVRCCRCAGRAARPSATQICDEGCGAMWCSPECAVADTHLHADSGECSFL
FT                   LDIGPDPRVAMCQPCGPGDRRTGRRRRVESDWVTLADDVRLLLRARRVGILEGGAEERL
FT                   ASLDANAPAPDDDDESSLLAAASEGSDATLRRIASIAVDAHKRRDGGGGGGIIPEDAEA
FT                   NDANEARDDDHAELDSWLRAALIVFANSFDVEAWGARRGSEFPRPARVAGAVYRTLSRF
FT                   NHSCAPNCTWSFVHESESKPGGGAVSVNVRAIKPVKSGDELTISYVDPTVGRAERREQL
FT                   WAKYRFECACHLCVGPRDVNRQLPGTDPYLEAVFGTIDEKDARATVEETDGMIRDVRAA
FT                   IRSIRTDEDVKKLDLAVDALRGKLRCRTRPFEVDRGEMAKLIEGEEARPRWTHSRRPDH
FT                   VSKAEHERLQGDGFHPFHFTSMEAYGILGVASSIKAKWLMFREPGDKAGIAKLMKIALG
FT                   YSMLRASALDELARKEAGFGDAASRAWMEVSERAMSCGVLERVDDPVRGPYRHLDQTYL
FT                   MSNAFRKVIECDDGGEDGILHSAVMCLPTAPGSMGGPAWHGTSFNGVDVALEPPSGTFE
FT                   IASDVAMNLADYHSPGLWKHIVGAFNAHQEEVGAATVPVSEDNIEKEEAKPARMAVGEE
FT                   CADDAKG"
     MGSSGEDGSK LELGKIVEVS GKGLGIVATR DAVAGEVVAR EQGPMAISLS RDQLGVRCCR        60
     CAGRAARPSA TQICDEGCGA MWCSPECAVA DTHLHADSGE CSFLLDIGPD PRVAMCQPCG       120
     PGDRRTGRRR RVESDWVTLA DDVRLLLRAR RVGILEGGAE ERLASLDANA PAPDDDDESS       180
     LLAAASEGSD ATLRRIASIA VDAHKRRDGG GGGGIIPEDA EANDANEARD DDHAELDSWL       240
     RAALIVFANS FDVEAWGARR GSEFPRPARV AGAVYRTLSR FNHSCAPNCT WSFVHESESK       300
     PGGGAVSVNV RAIKPVKSGD ELTISYVDPT VGRAERREQL WAKYRFECAC HLCVGPRDVN       360
     RQLPGTDPYL EAVFGTIDEK DARATVEETD GMIRDVRAAI RSIRTDEDVK KLDLAVDALR       420
     GKLRCRTRPF EVDRGEMAKL IEGEEARPRW THSRRPDHVS KAEHERLQGD GFHPFHFTSM       480
     EAYGILGVAS SIKAKWLMFR EPGDKAGIAK LMKIALGYSM LRASALDELA RKEAGFGDAA       540
     SRAWMEVSER AMSCGVLERV DDPVRGPYRH LDQTYLMSNA FRKVIECDDG GEDGILHSAV       600
     MCLPTAPGSM GGPAWHGTSF NGVDVALEPP SGTFEIASDV AMNLADYHSP GLWKHIVGAF       660
     NAHQEEVGAA TVPVSEDNIE KEEAKPARMA VGEECADDAK G                           701
//

If you have problems or comments...

PBIL Back to PBIL home page