(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE440

MICSR_1.PE440        Location/Qualifiers
FT   CDS             join(862127..862165,862282..862653,862930..867594)
FT                   /codon_start=1
FT                   /gene_family="HOG000188877" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637358"
FT                   /orf_name="MICPUN_105289"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin coat of coated pit "
FT                   /cellular_component="clathrin coat of trans-Golgi network
FT                   vesicle"
FT                   /protein_id="ACO61813.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030130"
FT                   /db_xref="GO:0030132"
FT                   /db_xref="HOGENOM:HBG317411"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR001473"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012331"
FT                   /db_xref="InterPro:IPR015348"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016025"
FT                   /db_xref="InterPro:IPR016341"
FT                   /db_xref="InterPro:IPR022365"
FT                   /db_xref="UniParc:UPI000199AB47"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W7"
FT                   /transl_table=1
FT                   /translation="MAAPPVTVKEVVSLTSSGINPQNISFTNLTMESEKFICVRETGAA
FT                   NSVVIVDMAQPMTPMKRPITADSALMNPAAKVIALKATVAGTAQDHLQIFNIDTKSKMK
FT                   SHQMPESVVYWRWISPSLMGIVTNTAVYHWSMEGDSEPQKMFDRTGNLNGCQIIAYRAS
FT                   QDMKWFSVVGIAAGDPSRPGLVKGKMQLFSKELGRSQELDAHACAFSTHQVTGNSVKSQ
FT                   VIAFAQKTVMPDGNVASKLHVIELGAQAGQTPFQKRQAELFFPPEFMDDFPVNMSISEK
FT                   YGVIYVVTKMGLLFVYDLETATAIYRNKVSNDPVFLACDSPSTGGVYAVNRRGQVLLLN
FT                   LNEPAVVPFISGQLNNVSLALQVAVRGGLPGAESLVKPKFEQLFAAGDIKGAAECAADS
FT                   PKGILRNPETIARFKAIPAQPGAAPPLLQYFGICLQRGTLNKVEGVELARLVLAQNKKQ
FT                   LLDTWMAEDKIECSEELGDLLQSVDADMALRVYIKAKANTKVVAALAARGEFEKMGKYC
FT                   EMADYKPDYSYLLQSTLMSNPQGAVTIALQVSKMNPPPLDYNTVADLFLQRNMIREATS
FT                   FLLDVLKEDREDQAAMQTKVLEINLVTFPNVADAILGQGKLTHYDRPRIAQLCEKAGLY
FT                   MRALEHYTEVSDLKRCCVNTHSIDPQALLEWFGTLSREWALECIKELLVSNPRQNLQII
FT                   VNVCKEYTEQIGADAILKLLEEHNSSEGMFFYLGALVATSTEPDHHQKYIEAAAKTGQI
FT                   KEVERITRESEHYDPEKAKVFLMEAKLPDARPLINVCDRFDMVDDLTTFLYQNKMLRYI
FT                   EGYVQKVNPSNTPVVVGALLDLECDEDFVQNLILSVRSLLPVGPLVEEVSKRNRLKMLT
FT                   PFLENLVAEGSTNADVHNALGMILIDSNTNPEHFLTTNEYYDSKVVGKYCEKRDPNLAC
FT                   VAYKRGNCDLELVEVTNKNSLFKLQSRYVVERMDADLWEHVLAEDNPHRRQLIDQVVST
FT                   ALPESKNPEQVSVTVKAFMTAEMPQELIELLEKIVIQNSAFSNNPNLQNLLILTAIKAD
FT                   TTRVMDYINRLDAFNGPEVGEIAVGNELYEEAFAIFKKFDLHVDAMKVLLENLENLERG
FT                   EEYANKVDLPEVWSQLAKAYLSQDLVSAAVAAYIKAKYTDDYLAVIDVAKRADDFDSMV
FT                   KYLAMVRKKVKEPKVDSELCYAYAKTDKLAELEEFITQPNAAKLDNVGDRCFDEGLYEA
FT                   AKVLFTTCSNWGRLASTLVKLHKFSEAVDAARKANNTRTWKEICFACVDEGEFRLAQLC
FT                   ALNIIVNADELEEISEYYQVRGRYEELLSLMEAGVGLERAHMGIFTELGILYAKFKPEK
FT                   LMEHLKLFSTRINIPKLIRACEEMHAWKELSFLYIAYDEYDNAAGVMMAHPDAWEHVGF
FT                   KDVCVKVANLEIYYKALEFYLVSHPTQLNDLLTVLTPRIDHSRVVALMRQANHLPLIKP
FT                   YLQAVQNTNMVAVNDAVNELCLEEEDFESLRTSIDTYDNFDQMSLANKCEKHELLEFRR
FT                   IAGFLYQKNAKWTKSVELSKKDGLYKDAMEAAAQSGDKDIAGDLLQFFIEQENKECFAA
FT                   MLYNCYDLLKPDEVLEIAWMKGLMEYAMPYMIQVMKDYTNKVDVLVEDKKDRNKEKADQ
FT                   EKEKVEQQMNQNMYAQLLPAALPAPGMETTGGMNNPGMYGQMGGVQPGMYGGY"
     MAAPPVTVKE VVSLTSSGIN PQNISFTNLT MESEKFICVR ETGAANSVVI VDMAQPMTPM        60
     KRPITADSAL MNPAAKVIAL KATVAGTAQD HLQIFNIDTK SKMKSHQMPE SVVYWRWISP       120
     SLMGIVTNTA VYHWSMEGDS EPQKMFDRTG NLNGCQIIAY RASQDMKWFS VVGIAAGDPS       180
     RPGLVKGKMQ LFSKELGRSQ ELDAHACAFS THQVTGNSVK SQVIAFAQKT VMPDGNVASK       240
     LHVIELGAQA GQTPFQKRQA ELFFPPEFMD DFPVNMSISE KYGVIYVVTK MGLLFVYDLE       300
     TATAIYRNKV SNDPVFLACD SPSTGGVYAV NRRGQVLLLN LNEPAVVPFI SGQLNNVSLA       360
     LQVAVRGGLP GAESLVKPKF EQLFAAGDIK GAAECAADSP KGILRNPETI ARFKAIPAQP       420
     GAAPPLLQYF GICLQRGTLN KVEGVELARL VLAQNKKQLL DTWMAEDKIE CSEELGDLLQ       480
     SVDADMALRV YIKAKANTKV VAALAARGEF EKMGKYCEMA DYKPDYSYLL QSTLMSNPQG       540
     AVTIALQVSK MNPPPLDYNT VADLFLQRNM IREATSFLLD VLKEDREDQA AMQTKVLEIN       600
     LVTFPNVADA ILGQGKLTHY DRPRIAQLCE KAGLYMRALE HYTEVSDLKR CCVNTHSIDP       660
     QALLEWFGTL SREWALECIK ELLVSNPRQN LQIIVNVCKE YTEQIGADAI LKLLEEHNSS       720
     EGMFFYLGAL VATSTEPDHH QKYIEAAAKT GQIKEVERIT RESEHYDPEK AKVFLMEAKL       780
     PDARPLINVC DRFDMVDDLT TFLYQNKMLR YIEGYVQKVN PSNTPVVVGA LLDLECDEDF       840
     VQNLILSVRS LLPVGPLVEE VSKRNRLKML TPFLENLVAE GSTNADVHNA LGMILIDSNT       900
     NPEHFLTTNE YYDSKVVGKY CEKRDPNLAC VAYKRGNCDL ELVEVTNKNS LFKLQSRYVV       960
     ERMDADLWEH VLAEDNPHRR QLIDQVVSTA LPESKNPEQV SVTVKAFMTA EMPQELIELL      1020
     EKIVIQNSAF SNNPNLQNLL ILTAIKADTT RVMDYINRLD AFNGPEVGEI AVGNELYEEA      1080
     FAIFKKFDLH VDAMKVLLEN LENLERGEEY ANKVDLPEVW SQLAKAYLSQ DLVSAAVAAY      1140
     IKAKYTDDYL AVIDVAKRAD DFDSMVKYLA MVRKKVKEPK VDSELCYAYA KTDKLAELEE      1200
     FITQPNAAKL DNVGDRCFDE GLYEAAKVLF TTCSNWGRLA STLVKLHKFS EAVDAARKAN      1260
     NTRTWKEICF ACVDEGEFRL AQLCALNIIV NADELEEISE YYQVRGRYEE LLSLMEAGVG      1320
     LERAHMGIFT ELGILYAKFK PEKLMEHLKL FSTRINIPKL IRACEEMHAW KELSFLYIAY      1380
     DEYDNAAGVM MAHPDAWEHV GFKDVCVKVA NLEIYYKALE FYLVSHPTQL NDLLTVLTPR      1440
     IDHSRVVALM RQANHLPLIK PYLQAVQNTN MVAVNDAVNE LCLEEEDFES LRTSIDTYDN      1500
     FDQMSLANKC EKHELLEFRR IAGFLYQKNA KWTKSVELSK KDGLYKDAME AAAQSGDKDI      1560
     AGDLLQFFIE QENKECFAAM LYNCYDLLKP DEVLEIAWMK GLMEYAMPYM IQVMKDYTNK      1620
     VDVLVEDKKD RNKEKADQEK EKVEQQMNQN MYAQLLPAAL PAPGMETTGG MNNPGMYGQM      1680
     GGVQPGMYGG Y                                                           1691
//

If you have problems or comments...

PBIL Back to PBIL home page