(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE441

MICSR_1.PE441        Location/Qualifiers
FT   CDS             867909..869153
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637359"
FT                   /orf_name="MICPUN_107928"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61814.1"
FT                   /db_xref="UniParc:UPI000199AB48"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W8"
FT                   /transl_table=1
FT                   /translation="MRMEKAKALREELDGVRTRSRRLLAKGNRLVERGVQLKAAAERVM
FT                   LGNEINKEDEARRLLVERKKVKDTLDLTTARAEVLAELASKLETAIIVLENATDEESVD
FT                   AAKALAADTLPAAKRASLQEFKTAPVSSRPASMGEDDVSQDSIAERFGRDSLEREFAAL
FT                   EITQLERMLRLTPDDPRISSEDTVVKEDDDDVVVSNTEPAWWQAPSQPKDADGATMTPR
FT                   EALLEVDRARVSSKGVQGHHVVALRKSCAVHGAGTIRVSDRLIGGKKDTAFRAGVGAAM
FT                   TAMETGEGETTGWSSLGGYEPTVFLSDLARDLGVTPERAGVLVANATARKSAAALLQAG
FT                   ASVRGGEAESARVDLKKLTSVLRTFRACAGEYLDLVAFGLEQQLSEAERKIVLGLVPKE
FT                   TSEDVRGAIRCALGL"
     MRMEKAKALR EELDGVRTRS RRLLAKGNRL VERGVQLKAA AERVMLGNEI NKEDEARRLL        60
     VERKKVKDTL DLTTARAEVL AELASKLETA IIVLENATDE ESVDAAKALA ADTLPAAKRA       120
     SLQEFKTAPV SSRPASMGED DVSQDSIAER FGRDSLEREF AALEITQLER MLRLTPDDPR       180
     ISSEDTVVKE DDDDVVVSNT EPAWWQAPSQ PKDADGATMT PREALLEVDR ARVSSKGVQG       240
     HHVVALRKSC AVHGAGTIRV SDRLIGGKKD TAFRAGVGAA MTAMETGEGE TTGWSSLGGY       300
     EPTVFLSDLA RDLGVTPERA GVLVANATAR KSAAALLQAG ASVRGGEAES ARVDLKKLTS       360
     VLRTFRACAG EYLDLVAFGL EQQLSEAERK IVLGLVPKET SEDVRGAIRC ALGL             414
//

If you have problems or comments...

PBIL Back to PBIL home page