(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE442

MICSR_1.PE442        Location/Qualifiers
FT   CDS             complement(871781..874495)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637360"
FT                   /orf_name="MICPUN_57025"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62240.1"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199AB49"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W9"
FT                   /transl_table=1
FT                   /translation="MCSRQPPGELAWGRAPRRRGGARNALPQPWKLRLDQRISGKSVRA
FT                   RLVTTRAPRGPGRRFETMQAGVASRSWAPDVADRRRGRGTRTSRRQRRVAVRAAQTGTR
FT                   DDSDDVTARDAWADLGPAGHRRGTNRIAETSAATAAVPAVDAPKSGLKVDPITAAAGGT
FT                   ALAAAGVVAALRSNPKATEELVHLKELMEHRAEVLREFGTGTGREMFPVIRRYAEQIQR
FT                   RYDVLLLPNGVETMIYAEIVKTGAIGAYESLYDNVRNVNLLGHPLKLKTIANLGHQPPV
FT                   PKVNMEDCEEFVTSVLFDDEDENVGLGIIPRPLEVQIYRNAMVTAVYLMEDTLEHFNVR
FT                   FFGTQYSFEFGRPDEGWRTSKNHPTLSDSALRRLVREEIQAPAVLRLAPGVEKNAGKVA
FT                   VALAGEVVGSAEINFLGLPLRFSLQPGGDEAFSSDIGRIPSLSEAGKLVPGGGEVLPNF
FT                   NPATAVIKQNVCSETLEIIENYVELYLESRPKQNIITNPFFFSKKLERETYVGFLSAVI
FT                   GSLENSVICELMGMDVVLNVGSAARDKKGKIKPPNLSTFKVSSDFGDNRREIEELVDWL
FT                   MKDPMYNIKAVPDNIERAIYCNVFELVTNILAGALSSLEIEILGRAVRLKLSEANKRDR
FT                   ADLAKLSRFRPSNEVLQKFSENFSAVPALQEVMMNVYAFVLAFVSYELSNVDVNLVGRK
FT                   LQFSLGVPSEVDERLAAEKMKEESEFNARLRQALNTLVEEMVEAAEEISGKEIDVNLEK
FT                   IEEYERDVLANVGLRASKVKDEVWKFASGVFGSRDDSEGAVAPTTGGASSSAVSNDDLD
FT                   SVIYKTFLAHHSPANKEFPFPYLSPKDFRFAVSDLVKIVRPGGGPDDKFTVSAAAVQKV
FT                   ANAADINGDGVIQWAEYYFAAKELSYLFEVKTP"
     MCSRQPPGEL AWGRAPRRRG GARNALPQPW KLRLDQRISG KSVRARLVTT RAPRGPGRRF        60
     ETMQAGVASR SWAPDVADRR RGRGTRTSRR QRRVAVRAAQ TGTRDDSDDV TARDAWADLG       120
     PAGHRRGTNR IAETSAATAA VPAVDAPKSG LKVDPITAAA GGTALAAAGV VAALRSNPKA       180
     TEELVHLKEL MEHRAEVLRE FGTGTGREMF PVIRRYAEQI QRRYDVLLLP NGVETMIYAE       240
     IVKTGAIGAY ESLYDNVRNV NLLGHPLKLK TIANLGHQPP VPKVNMEDCE EFVTSVLFDD       300
     EDENVGLGII PRPLEVQIYR NAMVTAVYLM EDTLEHFNVR FFGTQYSFEF GRPDEGWRTS       360
     KNHPTLSDSA LRRLVREEIQ APAVLRLAPG VEKNAGKVAV ALAGEVVGSA EINFLGLPLR       420
     FSLQPGGDEA FSSDIGRIPS LSEAGKLVPG GGEVLPNFNP ATAVIKQNVC SETLEIIENY       480
     VELYLESRPK QNIITNPFFF SKKLERETYV GFLSAVIGSL ENSVICELMG MDVVLNVGSA       540
     ARDKKGKIKP PNLSTFKVSS DFGDNRREIE ELVDWLMKDP MYNIKAVPDN IERAIYCNVF       600
     ELVTNILAGA LSSLEIEILG RAVRLKLSEA NKRDRADLAK LSRFRPSNEV LQKFSENFSA       660
     VPALQEVMMN VYAFVLAFVS YELSNVDVNL VGRKLQFSLG VPSEVDERLA AEKMKEESEF       720
     NARLRQALNT LVEEMVEAAE EISGKEIDVN LEKIEEYERD VLANVGLRAS KVKDEVWKFA       780
     SGVFGSRDDS EGAVAPTTGG ASSSAVSNDD LDSVIYKTFL AHHSPANKEF PFPYLSPKDF       840
     RFAVSDLVKI VRPGGGPDDK FTVSAAAVQK VANAADINGD GVIQWAEYYF AAKELSYLFE       900
     VKTP                                                                    904
//

If you have problems or comments...

PBIL Back to PBIL home page