(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE443

MICSR_1.PE443        Location/Qualifiers
FT   CDS             join(874645..875544,875605..875772)
FT                   /codon_start=1
FT                   /gene_family="HOG000084891" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637361"
FT                   /orf_name="MICPUN_79866"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61815.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG560215"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199AB4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X0"
FT                   /transl_table=1
FT                   /translation="MVPRVFVVSDIHTDFEENMKWVRGLSDTKYANDAIILAGDVSDDL
FT                   SVLGETLVLFASKFRHAFFTPGNHELWCKRRGPLKDGESEADRETIPDSMTKLERVLRL
FT                   CDECGVETRPRLIGDGERKLWIAPVVAWYHSSFDYEPDITETRVHPPHLVMSDFRLCEW
FT                   PGLDPKDESVAEAMDAVNDARGWGTFLEWLRRPEQSAADASVPIVSFSHFLPRLELCPE
FT                   KRMLFYPNLPKAVGSDFVMRRIQNLRAEQPPGTRRKRMHVHCFGHTHFGWDATIDGVRY
FT                   IQAPVSYPHEWKQRPGSLTPCCIFDWEQHGGFAPKMSARWSDHYASNPRTPQNTELAWW
FT                   VRGSALKGRADDESD"
     MVPRVFVVSD IHTDFEENMK WVRGLSDTKY ANDAIILAGD VSDDLSVLGE TLVLFASKFR        60
     HAFFTPGNHE LWCKRRGPLK DGESEADRET IPDSMTKLER VLRLCDECGV ETRPRLIGDG       120
     ERKLWIAPVV AWYHSSFDYE PDITETRVHP PHLVMSDFRL CEWPGLDPKD ESVAEAMDAV       180
     NDARGWGTFL EWLRRPEQSA ADASVPIVSF SHFLPRLELC PEKRMLFYPN LPKAVGSDFV       240
     MRRIQNLRAE QPPGTRRKRM HVHCFGHTHF GWDATIDGVR YIQAPVSYPH EWKQRPGSLT       300
     PCCIFDWEQH GGFAPKMSAR WSDHYASNPR TPQNTELAWW VRGSALKGRA DDESD            355
//

If you have problems or comments...

PBIL Back to PBIL home page