(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE444

MICSR_1.PE444        Location/Qualifiers
FT   CDS             complement(875860..876738)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637362"
FT                   /orf_name="MICPUN_57027"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62241.1"
FT                   /db_xref="InterPro:IPR013255"
FT                   /db_xref="UniParc:UPI000199AB4B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X1"
FT                   /transl_table=1
FT                   /translation="MSAAPPAMSNARPLDDVSNIIDLDALHKELEQARSNVEMWMARRE
FT                   LSMKEQVAVHKTNMAVAEEEYVSLVEREKDLATAAEELARRQEYQQAELDALQEEAAQA
FT                   KELGEDLPQQLQVLREQVTTEKDELERESTKVTGDEMVKAQMLQAHLSAVDLYRTRLGL
FT                   RFEIGDAEELRFFYRHVDPADHEREFMVAVRVVDAGGYELMDCDPDMGDAAQRLLAECN
FT                   RTDNLSGFVRGVRKLFRASVAEEEVAAAAAALREKAKVSAPSYAPADEPEPEPVAPRTP
FT                   FNTRPDDMVPL"
     MSAAPPAMSN ARPLDDVSNI IDLDALHKEL EQARSNVEMW MARRELSMKE QVAVHKTNMA        60
     VAEEEYVSLV EREKDLATAA EELARRQEYQ QAELDALQEE AAQAKELGED LPQQLQVLRE       120
     QVTTEKDELE RESTKVTGDE MVKAQMLQAH LSAVDLYRTR LGLRFEIGDA EELRFFYRHV       180
     DPADHEREFM VAVRVVDAGG YELMDCDPDM GDAAQRLLAE CNRTDNLSGF VRGVRKLFRA       240
     SVAEEEVAAA AAALREKAKV SAPSYAPADE PEPEPVAPRT PFNTRPDDMV PL               292
//

If you have problems or comments...

PBIL Back to PBIL home page