(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE445

MICSR_1.PE445        Location/Qualifiers
FT   CDS             878017..880236
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637363"
FT                   /orf_name="MICPUN_107929"
FT                   /product="Predicted protein"
FT                   /function="nucleotide binding"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61816.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AB4C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X2"
FT                   /transl_table=1
FT                   /translation="MSYFNMVFLAMFAISAFLIPGVQRKLIKEVDANMCTIEDYSVIIT
FT                   DLPDDVKDQELHKFFDKKVGKVQNVVVATNNAELLTLAFERQKAKELFHIQVAKYKKGR
FT                   EDPDVSDKKVEWLHEEAVKAKKGLRACDSAIRALQNDRGGDAKRAICAFVTFQEEADFL
FT                   KMFDMYRPGIFAWLWRPVDLRLRKKHRLRVKQAPPPADIRWENLQFNWAQRSFRQLNIS
FT                   LLTAVVLGLAFVSIAAVQMMAANAATPYDTEECRLNCHYGTDPVTMENEDLRNIYLKCY
FT                   EAEQEGDPKRDITQTPSPPPPPAYGRRLMAQDLVSSQANYVASHNGTCGAFDSFCYACY
FT                   CLEHISAGSVLDESEYCQPYIFGYTMQVVAQSVASAIVVVLNLLLKPLLVFLVRFEKHH
FT                   SASGEQMSVMLKLFMAQFFNTAILLVVLNGSFPWLRAQLEGTPVEGLLFQGEMEDFVPA
FT                   WYNEVGYALVISMVATPASQRIFSIIRLFRFKIGKFFASRNAVTQDQLNKAFEGMEFNL
FT                   AINYGELLNILFVTLTFSPGLPILVPLTSFAYMVRYGFDKYEFARVSKMPPWYSTILGM
FT                   GVAHLMAYACLGYLILAIWANSYYTMAPDPMIEGLIGSALYGFCDAWESLPEPLASVFG
FT                   TMSDPSEMARRALQKNTAIYTLTLFIIVVILFFRGLIATMRSILAEIYPAYFQTDKRQA
FT                   EGNPTFDLAIAGSQLLGARTYSIRDAPQYQAAFERIVWELDDGKL"
     MSYFNMVFLA MFAISAFLIP GVQRKLIKEV DANMCTIEDY SVIITDLPDD VKDQELHKFF        60
     DKKVGKVQNV VVATNNAELL TLAFERQKAK ELFHIQVAKY KKGREDPDVS DKKVEWLHEE       120
     AVKAKKGLRA CDSAIRALQN DRGGDAKRAI CAFVTFQEEA DFLKMFDMYR PGIFAWLWRP       180
     VDLRLRKKHR LRVKQAPPPA DIRWENLQFN WAQRSFRQLN ISLLTAVVLG LAFVSIAAVQ       240
     MMAANAATPY DTEECRLNCH YGTDPVTMEN EDLRNIYLKC YEAEQEGDPK RDITQTPSPP       300
     PPPAYGRRLM AQDLVSSQAN YVASHNGTCG AFDSFCYACY CLEHISAGSV LDESEYCQPY       360
     IFGYTMQVVA QSVASAIVVV LNLLLKPLLV FLVRFEKHHS ASGEQMSVML KLFMAQFFNT       420
     AILLVVLNGS FPWLRAQLEG TPVEGLLFQG EMEDFVPAWY NEVGYALVIS MVATPASQRI       480
     FSIIRLFRFK IGKFFASRNA VTQDQLNKAF EGMEFNLAIN YGELLNILFV TLTFSPGLPI       540
     LVPLTSFAYM VRYGFDKYEF ARVSKMPPWY STILGMGVAH LMAYACLGYL ILAIWANSYY       600
     TMAPDPMIEG LIGSALYGFC DAWESLPEPL ASVFGTMSDP SEMARRALQK NTAIYTLTLF       660
     IIVVILFFRG LIATMRSILA EIYPAYFQTD KRQAEGNPTF DLAIAGSQLL GARTYSIRDA       720
     PQYQAAFERI VWELDDGKL                                                    739
//

If you have problems or comments...

PBIL Back to PBIL home page