(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE446

MICSR_1.PE446        Location/Qualifiers
FT   CDS             883118..884770
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637364"
FT                   /orf_name="MICPUN_57030"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61817.1"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniParc:UPI000199AB4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X3"
FT                   /transl_table=1
FT                   /translation="MATKSFAELCEMSASKGGMEKTVKFTYDEHVSVVMAAFRERSQGP
FT                   HPSMPLVHRVDILDERPEKPDSDGTDTESWAMRYRRFFAENDAPPWVKKISGGEYLRGT
FT                   ERIEWSEPAGKMVMYTVNESHSQLVTAEEICIIEADPERPHTGTIKTLTVRARLRLRGW
FT                   WTLGISAIAERFLLGRYVSLVNQGRKIELEEIRKWRHTGKAELVLRGAFERSRTPSSER
FT                   ALGMILAGGTSKLPSLEPEADEGGKVSPKSTLSRLRGNSAPSVDGLEVESLEEFERSIS
FT                   EKDPRETTDEIVQAGMSEVHWLGLRYAKRREEIFDESSTDSDEYAYESTPRPESPLLSY
FT                   ASTDEDEYEYDSTPRPESPLYVPLDTDDEDVEDDENGEETPAVDAVIDDEFRSSGSPGA
FT                   ASPIWSPGDERTVLDVSVDEATIAKSLAKDWKEIEALEHEAIRRKLGLGEEDGDEGGAA
FT                   GALRRWLVRLALVGAGAAILRERRDQLLPLAVRAKKRWTRGRRPVKASASVVDAAAMVD
FT                   ESEEEGEVSAVVEAGEEAAAEAVTPEVDDADDE"
     MATKSFAELC EMSASKGGME KTVKFTYDEH VSVVMAAFRE RSQGPHPSMP LVHRVDILDE        60
     RPEKPDSDGT DTESWAMRYR RFFAENDAPP WVKKISGGEY LRGTERIEWS EPAGKMVMYT       120
     VNESHSQLVT AEEICIIEAD PERPHTGTIK TLTVRARLRL RGWWTLGISA IAERFLLGRY       180
     VSLVNQGRKI ELEEIRKWRH TGKAELVLRG AFERSRTPSS ERALGMILAG GTSKLPSLEP       240
     EADEGGKVSP KSTLSRLRGN SAPSVDGLEV ESLEEFERSI SEKDPRETTD EIVQAGMSEV       300
     HWLGLRYAKR REEIFDESST DSDEYAYEST PRPESPLLSY ASTDEDEYEY DSTPRPESPL       360
     YVPLDTDDED VEDDENGEET PAVDAVIDDE FRSSGSPGAA SPIWSPGDER TVLDVSVDEA       420
     TIAKSLAKDW KEIEALEHEA IRRKLGLGEE DGDEGGAAGA LRRWLVRLAL VGAGAAILRE       480
     RRDQLLPLAV RAKKRWTRGR RPVKASASVV DAAAMVDESE EEGEVSAVVE AGEEAAAEAV       540
     TPEVDDADDE                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page