(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE447

MICSR_1.PE447        Location/Qualifiers
FT   CDS             complement(884893..886434)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637365"
FT                   /orf_name="MICPUN_99522"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62242.1"
FT                   /db_xref="UniParc:UPI000199ABBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X4"
FT                   /transl_table=1
FT                   /translation="MRDTNVDWIHDLPFHSFDAGAYGRSVAHVAFTYSTPWLALTAVTV
FT                   VAWAQFHRGCLCGRRSLPRRPVALGMKPAMIMFLIMAWIACSLVPSAYTRFHEGSRDVD
FT                   DALHALDAHATGAMGHAARAKSAAAECSAALAAVDAQFKEHMAAALKVQRARQAAEQFA
FT                   AAAEGVGGVAWKDLDVLRGYDDKWERFDTWFTALSATTYGLLIVASLAPVVARLLMLST
FT                   ASRSTVDAVDAALRFAPFVAMIAAWLFLAASSPATVTFAETCHAWVPTVTRTVPTDSAR
FT                   FYFFCGVGESASVDAIPKIPAPSPAIASMRAASIEFRASVEAVLTLDTSLSNAGRNVTT
FT                   AALKRVERCEASGMEFETSVADSLGGCDPMGANLRTARESACGDAVTGIFWNNIAIMLL
FT                   AFVIFYHALRGWLWELWEWVAMGDVVYGGDSPVRKFSGKGYGSGASPRDVESQMERLEG
FT                   DVRGVKGDVKYVMGKVDEMVPLMRDLEAASRVNSPVGKGSPEEKLKQAAAALARR"
     MRDTNVDWIH DLPFHSFDAG AYGRSVAHVA FTYSTPWLAL TAVTVVAWAQ FHRGCLCGRR        60
     SLPRRPVALG MKPAMIMFLI MAWIACSLVP SAYTRFHEGS RDVDDALHAL DAHATGAMGH       120
     AARAKSAAAE CSAALAAVDA QFKEHMAAAL KVQRARQAAE QFAAAAEGVG GVAWKDLDVL       180
     RGYDDKWERF DTWFTALSAT TYGLLIVASL APVVARLLML STASRSTVDA VDAALRFAPF       240
     VAMIAAWLFL AASSPATVTF AETCHAWVPT VTRTVPTDSA RFYFFCGVGE SASVDAIPKI       300
     PAPSPAIASM RAASIEFRAS VEAVLTLDTS LSNAGRNVTT AALKRVERCE ASGMEFETSV       360
     ADSLGGCDPM GANLRTARES ACGDAVTGIF WNNIAIMLLA FVIFYHALRG WLWELWEWVA       420
     MGDVVYGGDS PVRKFSGKGY GSGASPRDVE SQMERLEGDV RGVKGDVKYV MGKVDEMVPL       480
     MRDLEAASRV NSPVGKGSPE EKLKQAAAAL ARR                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page