(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE449

MICSR_1.PE449        Location/Qualifiers
FT   CDS             join(complement(890009..>890782),
FT                   complement(889475..889870),complement(<889191..889441))
FT                   /codon_start=1
FT                   /gene_family="HOG000029870" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637367"
FT                   /orf_name="MICPUN_68096"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO62243.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG690163"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199ABC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X6"
FT                   /transl_table=1
FT                   /translation="KSGDVLTLECTSLAFGGRGVCKLPGGFVVFCDRAVPGETLEARVT
FT                   SLKGGGRFAEATKVSSISPCEHRTAAPCPHFERCGGCTWQDIAYAHQLTMKRDQVVDVM
FT                   TRVAKVDQTRVQNIVGDCVPSDKTERYRNKMEFAFGPGANGRGVVIGLRPSGNHSDLVE
FT                   IGNPDGCLLQHPVADEVLRGCRAHLDSNGNSSLLDAFNRRTGEGVLRSLTVRVAVDENG
FT                   ETIAAVDIAAATRGDDEDAALRGLAEAIAKVRGVASSGGGDADGEGWSGEDVEVLSGAA
FT                   TLPMKLRGVTFALSAPSFFQTNTDQAEKLVAAVEDACGFSGDGTEVVLDLFCGVGTLGL
FT                   CVAKKAKHVFGWEVVPEAVKDAERNAEANGITNATFRRGDLAKLKASLPGPDIVIADPA
FT                   RAGMDESLVKVLRSIGAERIVYVSCNPATQARDLLRLKGGDGGEGARYDVRYCTPVDMF
FT                   PHTPHVETVVVLDRI"
     KSGDVLTLEC TSLAFGGRGV CKLPGGFVVF CDRAVPGETL EARVTSLKGG GRFAEATKVS        60
     SISPCEHRTA APCPHFERCG GCTWQDIAYA HQLTMKRDQV VDVMTRVAKV DQTRVQNIVG       120
     DCVPSDKTER YRNKMEFAFG PGANGRGVVI GLRPSGNHSD LVEIGNPDGC LLQHPVADEV       180
     LRGCRAHLDS NGNSSLLDAF NRRTGEGVLR SLTVRVAVDE NGETIAAVDI AAATRGDDED       240
     AALRGLAEAI AKVRGVASSG GGDADGEGWS GEDVEVLSGA ATLPMKLRGV TFALSAPSFF       300
     QTNTDQAEKL VAAVEDACGF SGDGTEVVLD LFCGVGTLGL CVAKKAKHVF GWEVVPEAVK       360
     DAERNAEANG ITNATFRRGD LAKLKASLPG PDIVIADPAR AGMDESLVKV LRSIGAERIV       420
     YVSCNPATQA RDLLRLKGGD GGEGARYDVR YCTPVDMFPH TPHVETVVVL DRI              473
//

If you have problems or comments...

PBIL Back to PBIL home page