(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE450

MICSR_1.PE450        Location/Qualifiers
FT   CDS             891157..892089
FT                   /codon_start=1
FT                   /gene_family="HOG000264906" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637368"
FT                   /orf_name="MICPUN_57034"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61819.1"
FT                   /db_xref="HOGENOM:HBG560221"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="UniParc:UPI000199ABC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X7"
FT                   /transl_table=1
FT                   /translation="MAETAGPKIGDARSLWNFTPSPGWTKDECATLRLCLMKFGIGRWV
FT                   QIVDSGVLPGKQIQQLNGQTQRLLGQQSLAEYTGMHVDVDRIREDNNEKTGPDIYRKNG
FT                   LITNTGGKLKKEAMQALRAENKAKYGLSETEIAEIVLPDPPSKKKLGADAYMGKNHNKG
FT                   GVAGLTRRMEKRRRTADVLTVDVDALARPAKMALLKALRARLVVLTTAAEEGRVLKENK
FT                   AKAAAKPKPEAKKRAASSKRKSVDSASGEENDAPTPKRDTARRASAGCGGVVGQLVAMG
FT                   FDKKKAAEAVKEVGNDTMECVNWLVVNCA"
     MAETAGPKIG DARSLWNFTP SPGWTKDECA TLRLCLMKFG IGRWVQIVDS GVLPGKQIQQ        60
     LNGQTQRLLG QQSLAEYTGM HVDVDRIRED NNEKTGPDIY RKNGLITNTG GKLKKEAMQA       120
     LRAENKAKYG LSETEIAEIV LPDPPSKKKL GADAYMGKNH NKGGVAGLTR RMEKRRRTAD       180
     VLTVDVDALA RPAKMALLKA LRARLVVLTT AAEEGRVLKE NKAKAAAKPK PEAKKRAASS       240
     KRKSVDSASG EENDAPTPKR DTARRASAGC GGVVGQLVAM GFDKKKAAEA VKEVGNDTME       300
     CVNWLVVNCA                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page