(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE451

MICSR_1.PE451        Location/Qualifiers
FT   CDS             complement(<892698..892982)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637369"
FT                   /orf_name="MICPUN_79915"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62244.1"
FT                   /db_xref="InterPro:IPR019367"
FT                   /db_xref="UniParc:UPI000199ABC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X8"
FT                   /transl_table=1
FT                   /translation="MVCSKCEKKLSRGIHQEMWKDGSRHTIEGGGRKINQNMALSGKKR
FT                   WTPYGGATGGSKCKICKQSLHQQGIYCQKCAYHHGMCSMCGVKVMDTTFY"
     MVCSKCEKKL SRGIHQEMWK DGSRHTIEGG GRKINQNMAL SGKKRWTPYG GATGGSKCKI        60
     CKQSLHQQGI YCQKCAYHHG MCSMCGVKVM DTTFY                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page