(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE452

MICSR_1.PE452        Location/Qualifiers
FT   CDS             893098..894243
FT                   /codon_start=1
FT                   /gene_family="HOG000241816" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637370"
FT                   /orf_name="MICPUN_80110"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61820.1"
FT                   /db_xref="HOGENOM:HBG746219"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="UniParc:UPI000199ABC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X9"
FT                   /transl_table=1
FT                   /translation="MATTDEFVPLPQLADVDGYRPTTFDYDPPAGSKDPRGGTPPGKSE
FT                   WVDVFRKSIPEFRKRAAADPRVPDAASLADRFADDFSAALDRIHAGDHADLFEGQPTVL
FT                   KMCRLRDETLRSLGFTDCFKDVKATENERALTVLPAVLAEIDAIADAKDRLLALIQGAF
FT                   AGNIFDLGAAASAKLHEDGGGDFRSTRARLKSRPWLVDDFDSLHQAWTANGATGGELAS
FT                   TWRKCVMFVDNSGADVVLGMLPIARELARRGCKVVLAANEVASINDVTAAELEDLLPRV
FT                   AELDETFAEAVKCGAIAVCSSGSDLPVIDLRRVSKRLAAVVDDADFVILEGMGRAIETN
FT                   LEAAFDCDALRIGMVKHPEVAQCLGGELYDCVCRFEAAGYI"
     MATTDEFVPL PQLADVDGYR PTTFDYDPPA GSKDPRGGTP PGKSEWVDVF RKSIPEFRKR        60
     AAADPRVPDA ASLADRFADD FSAALDRIHA GDHADLFEGQ PTVLKMCRLR DETLRSLGFT       120
     DCFKDVKATE NERALTVLPA VLAEIDAIAD AKDRLLALIQ GAFAGNIFDL GAAASAKLHE       180
     DGGGDFRSTR ARLKSRPWLV DDFDSLHQAW TANGATGGEL ASTWRKCVMF VDNSGADVVL       240
     GMLPIARELA RRGCKVVLAA NEVASINDVT AAELEDLLPR VAELDETFAE AVKCGAIAVC       300
     SSGSDLPVID LRRVSKRLAA VVDDADFVIL EGMGRAIETN LEAAFDCDAL RIGMVKHPEV       360
     AQCLGGELYD CVCRFEAAGY I                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page