(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE453

MICSR_1.PE453        Location/Qualifiers
FT   CDS             join(complement(900067..900165),complement(894300..899870))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637371"
FT                   /orf_name="MICPUN_57037"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62245.1"
FT                   /db_xref="InterPro:IPR022113"
FT                   /db_xref="UniParc:UPI000199ABC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y0"
FT                   /transl_table=1
FT                   /translation="MRGDGRRSRAPWPLLIVLLLFLSWTGPTARAEKDPDQVAQGELSA
FT                   SAYAPSSVGADGQPAAAPPPKPDPGGRGAEIETYKDHDDFGKILYPPPRLPLGPQWAPS
FT                   VSIVPTELKFVETPLCQPTTHVIHVYNMDQRETFKILSLTTDAVYMQPVDFRSVEVPPG
FT                   RGRQLKVAFLPRSLGGSHGSFRLLTSKGSIVISARGVGVESPYKLQPLVGAKVPSGVPF
FT                   MWRLELFNPHSSTVKLVEALSSDHTISLGPPSVEDLESQNKFDEEDKAIMEKANNSGRG
FT                   GVRSFPSTIWELPSKSSKVVLSVKLLAAHAGRHEGSIKLVLNRTKGETYDINDVMERHE
FT                   LHVPVQFDAAHGGVFRSPDQIDFGIATRRLDRLRQTVTLFNSGAEPIRVMDVSLRPADP
FT                   SLRVKYTKGYILQPYTEEPVIQLVYSGKLEGVRMGTLLIRTSNSNIPIEVPYRAKIQHG
FT                   KLSWNEAEMSFLSPATGRKPFPAVSNTVRVLNNFRTPIAFHAVRVVNRPPRSNKNTEHT
FT                   EAQAQIAQGNEKPSEIAGALSTADDEEVCCFEVKDFTGGQVVSPGHPLAPFTIEYTPQD
FT                   KNVVFTATLELDTNLTTLEIPIEVHHGQLTCFDADQAEMRAKAAAEAAAMIAAAVVTKD
FT                   AAGNAPRDSDPAAEDSGDAVPCAVLAEGRKATRVGDDISQMGLIDFGVVGVPAERYRRV
FT                   AVYNPNPMPLTIKSVESSVRSVSVTRVEVSGSSLKTPISHVAPGSLLSTLHQTSHKPPP
FT                   PPPRCMTAEGKNVACKQEFWSVQHKGGSGAVIIPPLHIATVHVLAAPEREETAPKGALT
FT                   FYLDNGRQLIAPVAIKALKGTISVSGMNTPVVELPPTFPGRPILAPLKLRNDFRDVVTV
FT                   IGSRSTSPTFSLDLFAQKLKPGRDTTAGQVAFDPAHLPRQYAYTSLGRVRRKPESEKVI
FT                   DKRRSMFAAMLGADVDDSRTKTKAKTLYPDDVDELRRMTDAWRAVAADHGGHADAGAGA
FT                   FVTQTATVLLKTDAVDPFPIEVRSRLLRPSIFSVVEEEEEEPPKKTMDARFQYSTSKSK
FT                   PKSKGEGQRVLNKDGVVDFGSVQLDRRSPRHRVIATNPLGNQVVCVRIMPFVAAAEKSI
FT                   AEMEGDVDAATISAANLHVAGEYDPPGATGFVLEGGDISMKRKTGAGKGAAALVSDGRD
FT                   TACLEPGESVDLGLLSFKPKEVRKYHAHMCVRNNFTTLECATLSGSADAVKVYVAKKPR
FT                   GTQVVTDVGFRLARIGLGGADMLMQTVHVVNRGSVAVEVAKPYVGAFACGGDGSVGGYT
FT                   VQPCKPFTLPPGGSKQLTVACFTDKAAQAAKYARGVAGVWTALTMEVSSPDGVKTTLVA
FT                   NLHASDGIVTGAYAAGEMARSGPRSLIAWLATMCSGGAACWLFYANRASLQGAYERRKK
FT                   AAAAAAATRQEAVVAAVAAAAVATNGKKAKRRGSQDIGSPASPGATKSGSPKSPIVSSS
FT                   MDTESSLGSSPEKTESVLAKAPEPETSGMDSASGSSPALSPKISSSKLRDEKKPADKKS
FT                   DKEEAEVEKKEAAKSSSKPSSPVSPARKEKANGTDSKIKSVPAPRTAPSTESANGKVSP
FT                   KTTVSPKTSPANSFKQPAEKTSDKAKVIPKPKGGAAPNPFKQPKQQQERLREEQPATSQ
FT                   APRPEQLPTPNVTFAGKPIRTKASFGNEAGDDWITPPKPAAASPTYSEQSLLSPTGLAA
FT                   EATATAAGLSVLSSPYGHDIFASAPSSMQQQHQQPPLPPGPPPSMQHQQPPLPAGPRPP
FT                   NLRQDGTQQMTQQPLGGFAPVGLPGLGSIGGGASGYNMWADHFSQLGQAAAKPSNLATP
FT                   DDVRRLSESAGGSFFGGGLASATDGDALEPDGVGGGDGGGWGLWGSSHKPANSDLDDNE
FT                   WEQKNLDLLNDLELD"
     MRGDGRRSRA PWPLLIVLLL FLSWTGPTAR AEKDPDQVAQ GELSASAYAP SSVGADGQPA        60
     AAPPPKPDPG GRGAEIETYK DHDDFGKILY PPPRLPLGPQ WAPSVSIVPT ELKFVETPLC       120
     QPTTHVIHVY NMDQRETFKI LSLTTDAVYM QPVDFRSVEV PPGRGRQLKV AFLPRSLGGS       180
     HGSFRLLTSK GSIVISARGV GVESPYKLQP LVGAKVPSGV PFMWRLELFN PHSSTVKLVE       240
     ALSSDHTISL GPPSVEDLES QNKFDEEDKA IMEKANNSGR GGVRSFPSTI WELPSKSSKV       300
     VLSVKLLAAH AGRHEGSIKL VLNRTKGETY DINDVMERHE LHVPVQFDAA HGGVFRSPDQ       360
     IDFGIATRRL DRLRQTVTLF NSGAEPIRVM DVSLRPADPS LRVKYTKGYI LQPYTEEPVI       420
     QLVYSGKLEG VRMGTLLIRT SNSNIPIEVP YRAKIQHGKL SWNEAEMSFL SPATGRKPFP       480
     AVSNTVRVLN NFRTPIAFHA VRVVNRPPRS NKNTEHTEAQ AQIAQGNEKP SEIAGALSTA       540
     DDEEVCCFEV KDFTGGQVVS PGHPLAPFTI EYTPQDKNVV FTATLELDTN LTTLEIPIEV       600
     HHGQLTCFDA DQAEMRAKAA AEAAAMIAAA VVTKDAAGNA PRDSDPAAED SGDAVPCAVL       660
     AEGRKATRVG DDISQMGLID FGVVGVPAER YRRVAVYNPN PMPLTIKSVE SSVRSVSVTR       720
     VEVSGSSLKT PISHVAPGSL LSTLHQTSHK PPPPPPRCMT AEGKNVACKQ EFWSVQHKGG       780
     SGAVIIPPLH IATVHVLAAP EREETAPKGA LTFYLDNGRQ LIAPVAIKAL KGTISVSGMN       840
     TPVVELPPTF PGRPILAPLK LRNDFRDVVT VIGSRSTSPT FSLDLFAQKL KPGRDTTAGQ       900
     VAFDPAHLPR QYAYTSLGRV RRKPESEKVI DKRRSMFAAM LGADVDDSRT KTKAKTLYPD       960
     DVDELRRMTD AWRAVAADHG GHADAGAGAF VTQTATVLLK TDAVDPFPIE VRSRLLRPSI      1020
     FSVVEEEEEE PPKKTMDARF QYSTSKSKPK SKGEGQRVLN KDGVVDFGSV QLDRRSPRHR      1080
     VIATNPLGNQ VVCVRIMPFV AAAEKSIAEM EGDVDAATIS AANLHVAGEY DPPGATGFVL      1140
     EGGDISMKRK TGAGKGAAAL VSDGRDTACL EPGESVDLGL LSFKPKEVRK YHAHMCVRNN      1200
     FTTLECATLS GSADAVKVYV AKKPRGTQVV TDVGFRLARI GLGGADMLMQ TVHVVNRGSV      1260
     AVEVAKPYVG AFACGGDGSV GGYTVQPCKP FTLPPGGSKQ LTVACFTDKA AQAAKYARGV      1320
     AGVWTALTME VSSPDGVKTT LVANLHASDG IVTGAYAAGE MARSGPRSLI AWLATMCSGG      1380
     AACWLFYANR ASLQGAYERR KKAAAAAAAT RQEAVVAAVA AAAVATNGKK AKRRGSQDIG      1440
     SPASPGATKS GSPKSPIVSS SMDTESSLGS SPEKTESVLA KAPEPETSGM DSASGSSPAL      1500
     SPKISSSKLR DEKKPADKKS DKEEAEVEKK EAAKSSSKPS SPVSPARKEK ANGTDSKIKS      1560
     VPAPRTAPST ESANGKVSPK TTVSPKTSPA NSFKQPAEKT SDKAKVIPKP KGGAAPNPFK      1620
     QPKQQQERLR EEQPATSQAP RPEQLPTPNV TFAGKPIRTK ASFGNEAGDD WITPPKPAAA      1680
     SPTYSEQSLL SPTGLAAEAT ATAAGLSVLS SPYGHDIFAS APSSMQQQHQ QPPLPPGPPP      1740
     SMQHQQPPLP AGPRPPNLRQ DGTQQMTQQP LGGFAPVGLP GLGSIGGGAS GYNMWADHFS      1800
     QLGQAAAKPS NLATPDDVRR LSESAGGSFF GGGLASATDG DALEPDGVGG GDGGGWGLWG      1860
     SSHKPANSDL DDNEWEQKNL DLLNDLELD                                        1889
//

If you have problems or comments...

PBIL Back to PBIL home page