(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE454

MICSR_1.PE454        Location/Qualifiers
FT   CDS             900514..901929
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637372"
FT                   /orf_name="MICPUN_57038"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61821.1"
FT                   /db_xref="UniParc:UPI000199ABC6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y1"
FT                   /transl_table=1
FT                   /translation="MAHPAIASLGAGASSVVSSSARVARRQRAPVRVSGSASDRRAARV
FT                   GESERARQRRGRGIEAVAASTGVKVDRFGASVAADFPPRFERPSSPSCSVGLELDEDFL
FT                   DARDDAPDENEVTTTRQCLDSRKVALGSLALFVLVGGVAAIHPDPALAREVTLELPDFD
FT                   IPDFEVPDIPTTPMEFLEVVTTNPYAAVAASVAAYLVIPKAAELLVKYVLVPALVLLVA
FT                   YEASQNPDETIALVASAINQARDHPTVTSGIILAILALVLSPYILVAAGVGLIVSGVQL
FT                   LPEQLKPVLPAPVREIETQIEELQRAVDPGVKRARALGSQAKARGEKLRQEADAQKARL
FT                   EAERDRRLREQAEAAAQRIEDTRAALVAPVVTAQKAAEEAAKETLERAQDVTEAVAEAG
FT                   EGAGQTVKCTSYPTPQERSSCVDRQREERRQRESKRTEELREKASRLRANSAERERPVP
FT                   DVGKALLGSGESS"
     MAHPAIASLG AGASSVVSSS ARVARRQRAP VRVSGSASDR RAARVGESER ARQRRGRGIE        60
     AVAASTGVKV DRFGASVAAD FPPRFERPSS PSCSVGLELD EDFLDARDDA PDENEVTTTR       120
     QCLDSRKVAL GSLALFVLVG GVAAIHPDPA LAREVTLELP DFDIPDFEVP DIPTTPMEFL       180
     EVVTTNPYAA VAASVAAYLV IPKAAELLVK YVLVPALVLL VAYEASQNPD ETIALVASAI       240
     NQARDHPTVT SGIILAILAL VLSPYILVAA GVGLIVSGVQ LLPEQLKPVL PAPVREIETQ       300
     IEELQRAVDP GVKRARALGS QAKARGEKLR QEADAQKARL EAERDRRLRE QAEAAAQRIE       360
     DTRAALVAPV VTAQKAAEEA AKETLERAQD VTEAVAEAGE GAGQTVKCTS YPTPQERSSC       420
     VDRQREERRQ RESKRTEELR EKASRLRANS AERERPVPDV GKALLGSGES S                471
//

If you have problems or comments...

PBIL Back to PBIL home page