(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE456

MICSR_1.PE456        Location/Qualifiers
FT   CDS             902831..905368
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637374"
FT                   /orf_name="MICPUN_99528"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61823.1"
FT                   /db_xref="InterPro:IPR019321"
FT                   /db_xref="UniParc:UPI000199ABC8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y3"
FT                   /transl_table=1
FT                   /translation="MEAFLNPCVRSDGERLDPSLSPAPSLLAEDGRGVLYALGADGVIR
FT                   ACPARLLNAAARGSIADDALPTRVFKPEPPIDFEPRTISVSPSGHFAAVGGLRHDASAG
FT                   SGSIPPSSALAIVSLRTGGDRSGFEALEDGAPGCRCVPLLDDDFDRHPSMRPLRAAWHP
FT                   NSDGHLCVLLSDGTLHVFDAAVGPVAEQAFRLDPWGRGSRPGPYPLRPEIVDFAFAPPH
FT                   GWGALSLVLLGREGDVYVMCPFAPWGARYPRVTLESLQPPDENSEVWLATTFPTLRRNG
FT                   RGADNEDDDDGYDDDAGGGGGVVPSDDDDDDAGGGGGGAPSDDDDAFAGPTVAARPARI
FT                   EGVATALRGPLPLGTDPVDGDGDGGVIGRGAVARSLAAAPFAAGEGGGALLAVAHQRVV
FT                   ADERDERAPNEGRVSATLDVLILPQEPSPAWAALSEEDEAAAYEAAACDGGPVLTLAPI
FT                   AADDDDGSLQPLLAIDRVELASGEPTLRRPKTSVAAAQNELAPFVSVVWDPSCRDRVFC
FT                   CAGGAVHGVTLTWLAAVEGAVDEEEEGEKSGSELSLPTVVTLMDSPEVLLGVAPCGDPL
FT                   AEGLLLAVDATGAAYGLRPAPPLPEGIDAGNEDEAIDSAAASALAGGAEASAELRALAA
FT                   GPPGPPPAPPAGAAALKPGTIEGNAALAAAAIALKERHLRYAHRVHAATKRHSLRLGAE
FT                   IKRQRVEAKVIREGLEAVLARKEILAAKIERSVANHEEIRERLRKLAEAERSLPHPLTR
FT                   AESAFKTTLQANADDLPLLEAKLEELKRRCEAIGEDFATIGALAAGDGDVFERLAASDP
FT                   AIAAEIELQDAATKANLERVKEIELAVGPLDDF"
     MEAFLNPCVR SDGERLDPSL SPAPSLLAED GRGVLYALGA DGVIRACPAR LLNAAARGSI        60
     ADDALPTRVF KPEPPIDFEP RTISVSPSGH FAAVGGLRHD ASAGSGSIPP SSALAIVSLR       120
     TGGDRSGFEA LEDGAPGCRC VPLLDDDFDR HPSMRPLRAA WHPNSDGHLC VLLSDGTLHV       180
     FDAAVGPVAE QAFRLDPWGR GSRPGPYPLR PEIVDFAFAP PHGWGALSLV LLGREGDVYV       240
     MCPFAPWGAR YPRVTLESLQ PPDENSEVWL ATTFPTLRRN GRGADNEDDD DGYDDDAGGG       300
     GGVVPSDDDD DDAGGGGGGA PSDDDDAFAG PTVAARPARI EGVATALRGP LPLGTDPVDG       360
     DGDGGVIGRG AVARSLAAAP FAAGEGGGAL LAVAHQRVVA DERDERAPNE GRVSATLDVL       420
     ILPQEPSPAW AALSEEDEAA AYEAAACDGG PVLTLAPIAA DDDDGSLQPL LAIDRVELAS       480
     GEPTLRRPKT SVAAAQNELA PFVSVVWDPS CRDRVFCCAG GAVHGVTLTW LAAVEGAVDE       540
     EEEGEKSGSE LSLPTVVTLM DSPEVLLGVA PCGDPLAEGL LLAVDATGAA YGLRPAPPLP       600
     EGIDAGNEDE AIDSAAASAL AGGAEASAEL RALAAGPPGP PPAPPAGAAA LKPGTIEGNA       660
     ALAAAAIALK ERHLRYAHRV HAATKRHSLR LGAEIKRQRV EAKVIREGLE AVLARKEILA       720
     AKIERSVANH EEIRERLRKL AEAERSLPHP LTRAESAFKT TLQANADDLP LLEAKLEELK       780
     RRCEAIGEDF ATIGALAAGD GDVFERLAAS DPAIAAEIEL QDAATKANLE RVKEIELAVG       840
     PLDDF                                                                   845
//

If you have problems or comments...

PBIL Back to PBIL home page