(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE457

MICSR_1.PE457        Location/Qualifiers
FT   CDS             complement(905400..908927)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637375"
FT                   /orf_name="MICPUN_99529"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62246.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199AC3E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y4"
FT                   /transl_table=1
FT                   /translation="MRSTVWREVAESPNLTGIAGPRVRFQCLDANHKHVVLGANTGSLY
FT                   VFARTRADGPSPFGPDADAPEGPLRFMTVVSPPRQPSDDAAKDDPADDARTPQSAFASR
FT                   SRGVSPAIRRIKLSPRGDRCAIAYATGVLNVVEFRPGVERRGGSPKVIVQIPKAHASAD
FT                   VTWLEWSPDGDRLLSGDDKGVVGVTEFANNSVVANTLSLGSAVAQASFSRSGLMAALCT
FT                   NEAVDLLSVPTGVHPKVGTKPREGPYGGCFHVLARDAAPDGALVSKQPESEWMLAARPG
FT                   RRLWVAEAWLEGGTQGEPRSAVAATLKPDVPKGSRAPGAPEPRPGAKSRKWEFGRLHPL
FT                   GRTCVLSVAERALAVVEVPGGSLLEWCPLGEPGSVGIAAGVASAAAVDARAFLLAAPEH
FT                   GGGVWCLEAPATEAALVACVADVAAVAVASRARDGAGKDAGLAETLHAVSLATKLRVPE
FT                   TRLLEDARALVRDVAARRAVGDGGKVLDDEDDDFVDIDAELASAVEAYERFYAEAVGDA
FT                   PPPPPRPSLDERTTASSPPRPAAALSRSSSFASSAGASLSRGDSGLDATIVGAGEFPAA
FT                   ESGKFFFYNPNANAGERKERKSDKEEKKKKKSAKVVDVGDGTAPVDAPRPKRDKPKKSP
FT                   PAPEPIAETSPTNEDKKTAADMGSIVARLEEDRDDYLAAVKALSDLGEAPPVSPPPFLH
FT                   WTEYREIPALVEVGSAAAAAKSTTGKRREALRRARERRIDAAAVAARALRLSRRSLDAS
FT                   PLIPALRRWRLARAECDEIADEIDDVVEFGGGDETHATRQLSDSTQLAREDMFEALALV
FT                   ERELDVAVVELRLVGAEPAERRVGEAAARVFAEADAAEAAARTTKGTIVEPADDKAPKS
FT                   VDEPFDGDLGALAGSLVGALSLGEEERVERILRAIPPEDGEIVAVESFRRALVDLLSRP
FT                   DSAQPLESLESVTTVVAAALGAENALKALEVAVEDEAIEKKIGCDALETFAGNVFADAI
FT                   TCVTLDLVAAVGDERDRGRAASKILRPLEARVSDPPPSPVGRFPQLRAAIAAEASLKAS
FT                   PGDDAAMRRLPFVKKERGRWELAVTHTKPIEPTLEDPTGGWGVRVPLSTACCARCALPL
FT                   REIRWSGDAGQSSLGRLVTFPCGHTLHECCAIEDACVECAASNAKPLRSPAFITLSAAI
FT                   NAELESLRL"
     MRSTVWREVA ESPNLTGIAG PRVRFQCLDA NHKHVVLGAN TGSLYVFART RADGPSPFGP        60
     DADAPEGPLR FMTVVSPPRQ PSDDAAKDDP ADDARTPQSA FASRSRGVSP AIRRIKLSPR       120
     GDRCAIAYAT GVLNVVEFRP GVERRGGSPK VIVQIPKAHA SADVTWLEWS PDGDRLLSGD       180
     DKGVVGVTEF ANNSVVANTL SLGSAVAQAS FSRSGLMAAL CTNEAVDLLS VPTGVHPKVG       240
     TKPREGPYGG CFHVLARDAA PDGALVSKQP ESEWMLAARP GRRLWVAEAW LEGGTQGEPR       300
     SAVAATLKPD VPKGSRAPGA PEPRPGAKSR KWEFGRLHPL GRTCVLSVAE RALAVVEVPG       360
     GSLLEWCPLG EPGSVGIAAG VASAAAVDAR AFLLAAPEHG GGVWCLEAPA TEAALVACVA       420
     DVAAVAVASR ARDGAGKDAG LAETLHAVSL ATKLRVPETR LLEDARALVR DVAARRAVGD       480
     GGKVLDDEDD DFVDIDAELA SAVEAYERFY AEAVGDAPPP PPRPSLDERT TASSPPRPAA       540
     ALSRSSSFAS SAGASLSRGD SGLDATIVGA GEFPAAESGK FFFYNPNANA GERKERKSDK       600
     EEKKKKKSAK VVDVGDGTAP VDAPRPKRDK PKKSPPAPEP IAETSPTNED KKTAADMGSI       660
     VARLEEDRDD YLAAVKALSD LGEAPPVSPP PFLHWTEYRE IPALVEVGSA AAAAKSTTGK       720
     RREALRRARE RRIDAAAVAA RALRLSRRSL DASPLIPALR RWRLARAECD EIADEIDDVV       780
     EFGGGDETHA TRQLSDSTQL AREDMFEALA LVERELDVAV VELRLVGAEP AERRVGEAAA       840
     RVFAEADAAE AAARTTKGTI VEPADDKAPK SVDEPFDGDL GALAGSLVGA LSLGEEERVE       900
     RILRAIPPED GEIVAVESFR RALVDLLSRP DSAQPLESLE SVTTVVAAAL GAENALKALE       960
     VAVEDEAIEK KIGCDALETF AGNVFADAIT CVTLDLVAAV GDERDRGRAA SKILRPLEAR      1020
     VSDPPPSPVG RFPQLRAAIA AEASLKASPG DDAAMRRLPF VKKERGRWEL AVTHTKPIEP      1080
     TLEDPTGGWG VRVPLSTACC ARCALPLREI RWSGDAGQSS LGRLVTFPCG HTLHECCAIE      1140
     DACVECAASN AKPLRSPAFI TLSAAINAEL ESLRL                                 1175
//

If you have problems or comments...

PBIL Back to PBIL home page