(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE458

MICSR_1.PE458        Location/Qualifiers
FT   CDS             join(complement(910257..910271),complement(910004..910082),
FT                   complement(909283..909617))
FT                   /codon_start=1
FT                   /gene_family="HOG000019803" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637376"
FT                   /orf_name="MICPUN_93705"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO62247.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG518785"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniParc:UPI000199AC3F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y5"
FT                   /transl_table=1
FT                   /translation="MATQSVQTFGRKKTAVAVVHCKAGKGLIRFNGAPIELIQPETLKF
FT                   KAMEPIILLGRQRFANLDLRIRVKGGGHVSQMYAVRQAIAKAIVAYYQKYVDEQSKKEL
FT                   KDALLTYDRTLLVADPRRMEPKKFGGRGARARFQKSYR"
     MATQSVQTFG RKKTAVAVVH CKAGKGLIRF NGAPIELIQP ETLKFKAMEP IILLGRQRFA        60
     NLDLRIRVKG GGHVSQMYAV RQAIAKAIVA YYQKYVDEQS KKELKDALLT YDRTLLVADP       120
     RRMEPKKFGG RGARARFQKS YR                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page