(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE459

MICSR_1.PE459        Location/Qualifiers
FT   CDS             910598..913033
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637377"
FT                   /orf_name="MICPUN_99531"
FT                   /product="Glycosyltransferase family 60 protein "
FT                   /function="heat shock protein binding"
FT                   /function="transferase activity"
FT                   /protein_id="ACO61824.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR021067"
FT                   /db_xref="UniParc:UPI000199AC40"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y6"
FT                   /transl_table=1
FT                   /translation="MAPATPNARPSFASSAGEPSDTPHVPGRNHARLVAEIAREFRPRL
FT                   DTEGFSAVRELGSQLRELGVESNDDAPAHTHKRCKMCGNVCHARMNSCSSCCLPFVDRG
FT                   SWEPATMPRPGGDVHSETDSDSDSDSDSDDETEVDHVTEPTAPAVNAASAMERRRRERR
FT                   AAAAVPSGGPVGGPVASDSADATTRPGWHDWFNRTGRLREAPTHERGLDPTLERSYAAL
FT                   GCAFGATEADVRIAYRKCVRRVHPDSGGSRKQLARVHDALEAIDRDAWSHGEGAAALRE
FT                   ALVASESEPVSTETGAKKPRVFVSLAVYRDPEGLHTLKDAFDRASDPSRIFAGVHWQHV
FT                   LAKPSGEEPVVDRLHPAQNMFTRQVEANLGKIQGDEDKVRYLEESMKQQGDNQRDLDEK
FT                   EARLHAKASLDATDGTKWEWAGHVRETRESWECAEGPCRARHMSMRLWGGEEYVLHADS
FT                   RTRFDHGWDDVLIAELERIQTLTNNPAVLTGVPLGYHMRMTPVDNPETYERVGYLPVYG
FT                   RDEEREHELSNLVVPLRRDRTDDAPSIAALGVCGFGDLLCYPAAVRLAPYDAADADEPP
FT                   LPAMLVNPSFVFAPAKALVADAPPDLHAPFLYLGEELITSARLWTKGWRTYLPRHCPLR
FT                   VCYDPRNRIDETREDKRRGAQLYDHPRSEAARGTWDQLEERYFMNLQSRRRVLQVIGAP
FT                   DPDSATRDPRDAVILKEPWAPGSVRPVSEFVKSLGVDFDEREISNTSRYAGLDRDALNM
FT                   THDTRAVKKRDTFAARTDATELGDDVLADDGLPLKWKNGSPLFGDLSAGYYERTERWS"
     MAPATPNARP SFASSAGEPS DTPHVPGRNH ARLVAEIARE FRPRLDTEGF SAVRELGSQL        60
     RELGVESNDD APAHTHKRCK MCGNVCHARM NSCSSCCLPF VDRGSWEPAT MPRPGGDVHS       120
     ETDSDSDSDS DSDDETEVDH VTEPTAPAVN AASAMERRRR ERRAAAAVPS GGPVGGPVAS       180
     DSADATTRPG WHDWFNRTGR LREAPTHERG LDPTLERSYA ALGCAFGATE ADVRIAYRKC       240
     VRRVHPDSGG SRKQLARVHD ALEAIDRDAW SHGEGAAALR EALVASESEP VSTETGAKKP       300
     RVFVSLAVYR DPEGLHTLKD AFDRASDPSR IFAGVHWQHV LAKPSGEEPV VDRLHPAQNM       360
     FTRQVEANLG KIQGDEDKVR YLEESMKQQG DNQRDLDEKE ARLHAKASLD ATDGTKWEWA       420
     GHVRETRESW ECAEGPCRAR HMSMRLWGGE EYVLHADSRT RFDHGWDDVL IAELERIQTL       480
     TNNPAVLTGV PLGYHMRMTP VDNPETYERV GYLPVYGRDE EREHELSNLV VPLRRDRTDD       540
     APSIAALGVC GFGDLLCYPA AVRLAPYDAA DADEPPLPAM LVNPSFVFAP AKALVADAPP       600
     DLHAPFLYLG EELITSARLW TKGWRTYLPR HCPLRVCYDP RNRIDETRED KRRGAQLYDH       660
     PRSEAARGTW DQLEERYFMN LQSRRRVLQV IGAPDPDSAT RDPRDAVILK EPWAPGSVRP       720
     VSEFVKSLGV DFDEREISNT SRYAGLDRDA LNMTHDTRAV KKRDTFAART DATELGDDVL       780
     ADDGLPLKWK NGSPLFGDLS AGYYERTERW S                                      811
//

If you have problems or comments...

PBIL Back to PBIL home page