(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE46

MICSR_1.PE46         Location/Qualifiers
FT   CDS             89706..91805
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636051"
FT                   /orf_name="MICPUN_52109"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO61606.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199ABA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S3"
FT                   /transl_table=1
FT                   /translation="MGPKKGGTKKAAQTAKTAKAAGKKPPGRPRKVKEPVQEEEPAEDA
FT                   PADDDQADDEKGSGRSEPADDATPMDDADPVEAKATDDDAPAAKEDPPAADGEADDKTK
FT                   AGGDEPHPTIGTVPDETVRSCLRIVVPSDKAGYVIGPRGKIVAHARKESGCGFHLQETS
FT                   KTHAARVAVVTCADKRSEPGSFQGVRGVEMVYLRSTEEMIPKDADLNDPPMGARPEQTQ
FT                   TQRVHIIVAASQMEKADVSELATGAGADCEKVVALEKGSKDCEALHAALGSIVFPTDRF
FT                   VEIVGTDAAVRAALTVLMMRLDYRANPPIASEDPLLLIDAPDVKEGYFREKKEKDRLQR
FT                   ARDSHGAGRDGRGRHHPYGGGGRGGGGGGNYDRGPPPRGSGGGGGGDEIRMTFGIDAQF
FT                   AGGVIGKMGSNVGQIRRESGARITVHESHGKFRVVAIEGTDRQCHDAKHLVQQAVTKQG
FT                   GGPVGAHRIEPSTGRGGRDGRGRDTAVHRDPVVRGGAAGGGSYYDQYDRRGRGDRGYDR
FT                   GGYDRGGYDRGGYDRGGYDRGGYDRGGGYGRDAYYDAQGPGSAYADRSSYPDRGGYGGG
FT                   GRDAPHYDERDTHRQWLGGDRDGGYNNYQGVQQSHQQQQGWAGQNQQWGGSNQQQSYNN
FT                   QQPSYHGQQQSYDQGGGYNNNQQGGGNDYYNRGQQQSGYGNQGGQYDQQGDYYSRGQQW
FT                   GGSRY"
     MGPKKGGTKK AAQTAKTAKA AGKKPPGRPR KVKEPVQEEE PAEDAPADDD QADDEKGSGR        60
     SEPADDATPM DDADPVEAKA TDDDAPAAKE DPPAADGEAD DKTKAGGDEP HPTIGTVPDE       120
     TVRSCLRIVV PSDKAGYVIG PRGKIVAHAR KESGCGFHLQ ETSKTHAARV AVVTCADKRS       180
     EPGSFQGVRG VEMVYLRSTE EMIPKDADLN DPPMGARPEQ TQTQRVHIIV AASQMEKADV       240
     SELATGAGAD CEKVVALEKG SKDCEALHAA LGSIVFPTDR FVEIVGTDAA VRAALTVLMM       300
     RLDYRANPPI ASEDPLLLID APDVKEGYFR EKKEKDRLQR ARDSHGAGRD GRGRHHPYGG       360
     GGRGGGGGGN YDRGPPPRGS GGGGGGDEIR MTFGIDAQFA GGVIGKMGSN VGQIRRESGA       420
     RITVHESHGK FRVVAIEGTD RQCHDAKHLV QQAVTKQGGG PVGAHRIEPS TGRGGRDGRG       480
     RDTAVHRDPV VRGGAAGGGS YYDQYDRRGR GDRGYDRGGY DRGGYDRGGY DRGGYDRGGY       540
     DRGGGYGRDA YYDAQGPGSA YADRSSYPDR GGYGGGGRDA PHYDERDTHR QWLGGDRDGG       600
     YNNYQGVQQS HQQQQGWAGQ NQQWGGSNQQ QSYNNQQPSY HGQQQSYDQG GGYNNNQQGG       660
     GNDYYNRGQQ QSGYGNQGGQ YDQQGDYYSR GQQWGGSRY                              699
//

If you have problems or comments...

PBIL Back to PBIL home page