(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE460

MICSR_1.PE460        Location/Qualifiers
FT   CDS             complement(913082..913807)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637378"
FT                   /orf_name="MICPUN_107931"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62248.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI000199AC41"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y7"
FT                   /transl_table=1
FT                   /translation="MWGALCPIVFGERRWAQLSDAKQYEIRLAFNCAVNGILAPALVYP
FT                   ALTSTPPLNQNGLYATVFPRHEGSVLGCAASVGYLLYDLLAMLSNFTVSIKANGVVAYN
FT                   LYIWHHALSIMFWPVAVLHNSFVFFVNWFVASEASSTFLAARGAMLSLGTINTPVGVAV
FT                   QLGFVASFFMSRIYVMPNLIKSIYYADWGQVPAWQANIARCTVPLPFLLNIYWWMMILR
FT                   SMYKVIFGKKRGGKGKKAA"
     MWGALCPIVF GERRWAQLSD AKQYEIRLAF NCAVNGILAP ALVYPALTST PPLNQNGLYA        60
     TVFPRHEGSV LGCAASVGYL LYDLLAMLSN FTVSIKANGV VAYNLYIWHH ALSIMFWPVA       120
     VLHNSFVFFV NWFVASEASS TFLAARGAML SLGTINTPVG VAVQLGFVAS FFMSRIYVMP       180
     NLIKSIYYAD WGQVPAWQAN IARCTVPLPF LLNIYWWMMI LRSMYKVIFG KKRGGKGKKA       240
     A                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page