(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE461

MICSR_1.PE461        Location/Qualifiers
FT   CDS             join(<914135..914704,914816..>914920)
FT                   /codon_start=1
FT                   /gene_family="HOG000021237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637379"
FT                   /orf_name="MICPUN_70512"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61825.1"
FT                   /db_xref="HOGENOM:HBG381802"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniParc:UPI000199AC42"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y8"
FT                   /transl_table=1
FT                   /translation="CTVDRVHWTEMTADRFDGQYRDHKPVVLTGMRGRNDAFRNACAKD
FT                   VLLREWGDKDIVLSTANTHSYLKVTKTLREYVSSHTAPQRLDRRGDETLIWFGDNNHTE
FT                   WRSHFDLYVPPPFGTSDADVAYSFGVGGPHSGVPLHVHGPGWSETIVGRKRWWLSPPKP
FT                   KPRFHPNATSLEWALGLKPLQEGDEGRMLECTIGEGEAVWFPDGWWHATLNLDESAFIS
FT                   SFV"
     CTVDRVHWTE MTADRFDGQY RDHKPVVLTG MRGRNDAFRN ACAKDVLLRE WGDKDIVLST        60
     ANTHSYLKVT KTLREYVSSH TAPQRLDRRG DETLIWFGDN NHTEWRSHFD LYVPPPFGTS       120
     DADVAYSFGV GGPHSGVPLH VHGPGWSETI VGRKRWWLSP PKPKPRFHPN ATSLEWALGL       180
     KPLQEGDEGR MLECTIGEGE AVWFPDGWWH ATLNLDESAF ISSFV                       225
//

If you have problems or comments...

PBIL Back to PBIL home page