(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE462

MICSR_1.PE462        Location/Qualifiers
FT   CDS             join(complement(919382..919867),complement(918633..919309),
FT                   complement(915832..916045))
FT                   /codon_start=1
FT                   /gene_family="HOG000199411" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637380"
FT                   /orf_name="MICPUN_80084"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62249.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015748"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AC43"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y9"
FT                   /transl_table=1
FT                   /translation="MGACVSIDRSNSIDGARDPRVPRFERPRRAGFSGRTAADLHLDRI
FT                   DIDDVRCVEGGNGPDGHTTGDLGGDRRAEAKGTRSPRKAVDEDEIVQSPSREESPRAVA
FT                   EFVGDDDSTEDSEERTIRWQRGELVGSGGFGRVYVGLDLDTGGMLAVKQIAIAPRISRS
FT                   VRRIEQEVALMRRLKHPNIVSYLGTERTREDVFTIFMEYVSGGSIHSLLQRFGSFGESV
FT                   IRVYTRQILLGLEYLHRHQIMHRDIKGANILVDNQGCVKLADFGASKRLAEIVTVDGVH
FT                   KSIRGTPYWMAPEVIKQTGHGRQADIWSVGCTILEMATGKPPFSEFGSQVSALFHIASS
FT                   TGPPPIPEFLSAEAHDFLILCFNRVPRDRPNATRLLRHPFAVPAPSSGSPTPPRCCKRA
FT                   SWSSSTPSARSSTWRCTFTEDLQTRTSVMRSCSCGSFQRRSPSPTWRTQSGRRRQNARS
FT                   "
     MGACVSIDRS NSIDGARDPR VPRFERPRRA GFSGRTAADL HLDRIDIDDV RCVEGGNGPD        60
     GHTTGDLGGD RRAEAKGTRS PRKAVDEDEI VQSPSREESP RAVAEFVGDD DSTEDSEERT       120
     IRWQRGELVG SGGFGRVYVG LDLDTGGMLA VKQIAIAPRI SRSVRRIEQE VALMRRLKHP       180
     NIVSYLGTER TREDVFTIFM EYVSGGSIHS LLQRFGSFGE SVIRVYTRQI LLGLEYLHRH       240
     QIMHRDIKGA NILVDNQGCV KLADFGASKR LAEIVTVDGV HKSIRGTPYW MAPEVIKQTG       300
     HGRQADIWSV GCTILEMATG KPPFSEFGSQ VSALFHIASS TGPPPIPEFL SAEAHDFLIL       360
     CFNRVPRDRP NATRLLRHPF AVPAPSSGSP TPPRCCKRAS WSSSTPSARS STWRCTFTED       420
     LQTRTSVMRS CSCGSFQRRS PSPTWRTQSG RRRQNARS                               458
//

If you have problems or comments...

PBIL Back to PBIL home page