(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE463

MICSR_1.PE463        Location/Qualifiers
FT   CDS             join(920480..920590,920669..>921646)
FT                   /codon_start=1
FT                   /gene_family="HOG000200795" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637381"
FT                   /orf_name="MICPUN_68182"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61826.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG316723"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199AC44"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z0"
FT                   /transl_table=1
FT                   /translation="MGPRTPVRVEDLVALANTSTWAEPDAVNYRVVKDADDYQSPIINV
FT                   AHLTGLEGNAHYHYAIPGDTKTHRHFNAPPDSLKESSEDAAAGKEVHASTVFAVVGDTG
FT                   QTEVTAAVFEHIAGMDDADVLLHTGDLSYADGFPPRWDTFGRLAEGVMDRLPSLFVAGN
FT                   HDVTSNGVESQAYHTRYPSPHRSSGSASPEWWSLDVGLAHVIGFSSYAPSKGPGAFDGA
FT                   DAPLTRWLEKDLKKVNRAITPWIIVVFHVPWYNSNHGHFKEAERARVALEKLLYEAGVD
FT                   VVLNGHVHSYERIRAVYDYQPNECGVSHIVVGDGGNYEGPYGESWMNPQPAWSAFREGS
FT                   FGAGRLELHNATHATWEWRRTTC"
     MGPRTPVRVE DLVALANTST WAEPDAVNYR VVKDADDYQS PIINVAHLTG LEGNAHYHYA        60
     IPGDTKTHRH FNAPPDSLKE SSEDAAAGKE VHASTVFAVV GDTGQTEVTA AVFEHIAGMD       120
     DADVLLHTGD LSYADGFPPR WDTFGRLAEG VMDRLPSLFV AGNHDVTSNG VESQAYHTRY       180
     PSPHRSSGSA SPEWWSLDVG LAHVIGFSSY APSKGPGAFD GADAPLTRWL EKDLKKVNRA       240
     ITPWIIVVFH VPWYNSNHGH FKEAERARVA LEKLLYEAGV DVVLNGHVHS YERIRAVYDY       300
     QPNECGVSHI VVGDGGNYEG PYGESWMNPQ PAWSAFREGS FGAGRLELHN ATHATWEWRR       360
     TTC                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page