(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE464

MICSR_1.PE464        Location/Qualifiers
FT   CDS             join(complement(923318..923411),complement(922121..923217))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637382"
FT                   /orf_name="MICPUN_57048"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO62250.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR015465"
FT                   /db_xref="UniParc:UPI000199AC45"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z1"
FT                   /transl_table=1
FT                   /translation="MARGGHSHILKVGKSARQKGRVPSHHSASMRTTASSDFAFGHHSR
FT                   GSLDTAPGRTMMVALAQQVSALITSRAAPAGPSRARAPLVARATGPSRFPGAGMSFRNS
FT                   AAAARRWSEAPKRRSVAPRAADDDWEKLFADLKPLAPELSAAQVEVLERALARGRRQVP
FT                   ITDVAKELELRRDDVLAWVKSNAHRVPELAKRYPPQPEKVATVRLRERPDFDRREGRGI
FT                   RDVDRDDEREYDAQTAYLRNAPGAKHVPKGAPAYKGYVKTRLGANNVATLEKVYASDTH
FT                   PSDDMVESVRRATKLPRSKIVAWFKTRREEDKMAKRRAVRERYGGEEEDDGYYDERGGD
FT                   GFYERRGRGGRGGGGGRRGGRGGGGGLREGGAGDAYGARQERGRRDSTGEWSGRRG"
     MARGGHSHIL KVGKSARQKG RVPSHHSASM RTTASSDFAF GHHSRGSLDT APGRTMMVAL        60
     AQQVSALITS RAAPAGPSRA RAPLVARATG PSRFPGAGMS FRNSAAAARR WSEAPKRRSV       120
     APRAADDDWE KLFADLKPLA PELSAAQVEV LERALARGRR QVPITDVAKE LELRRDDVLA       180
     WVKSNAHRVP ELAKRYPPQP EKVATVRLRE RPDFDRREGR GIRDVDRDDE REYDAQTAYL       240
     RNAPGAKHVP KGAPAYKGYV KTRLGANNVA TLEKVYASDT HPSDDMVESV RRATKLPRSK       300
     IVAWFKTRRE EDKMAKRRAV RERYGGEEED DGYYDERGGD GFYERRGRGG RGGGGGRRGG       360
     RGGGGGLREG GAGDAYGARQ ERGRRDSTGE WSGRRG                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page