(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE465

MICSR_1.PE465        Location/Qualifiers
FT   CDS             923611..924441
FT                   /codon_start=1
FT                   /gene_family="HOG000100028" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637383"
FT                   /orf_name="MICPUN_57049"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61827.1"
FT                   /db_xref="HOGENOM:HBG560231"
FT                   /db_xref="UniParc:UPI000199AC46"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z2"
FT                   /transl_table=1
FT                   /translation="MDSSTSLTRTETPKSKPDVKKEVIPPKVQHSFEDIEGLINNLLML
FT                   NTFTLGFSISFLAAFENEALLAMDQRYFNVFTGAFKGSADDSGKLMIKSFGEQHIGEDY
FT                   SLSPSGTILVRGMRSTTCLTFSLIVGLASYVSMCLSDAREDQKFFIKWYSWFKWIILSG
FT                   YCLYVAGFTLFYLMVAASAYALFPMYCGAKRGFLSNSVWLDTKVDFDASGAPQEGCFIK
FT                   GMKDPVGDTTLILNIMMPAILLFCGIVTYAMHYKTKVIKSGRVGADGTLYGRWK"
     MDSSTSLTRT ETPKSKPDVK KEVIPPKVQH SFEDIEGLIN NLLMLNTFTL GFSISFLAAF        60
     ENEALLAMDQ RYFNVFTGAF KGSADDSGKL MIKSFGEQHI GEDYSLSPSG TILVRGMRST       120
     TCLTFSLIVG LASYVSMCLS DAREDQKFFI KWYSWFKWII LSGYCLYVAG FTLFYLMVAA       180
     SAYALFPMYC GAKRGFLSNS VWLDTKVDFD ASGAPQEGCF IKGMKDPVGD TTLILNIMMP       240
     AILLFCGIVT YAMHYKTKVI KSGRVGADGT LYGRWK                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page