(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE466

MICSR_1.PE466        Location/Qualifiers
FT   CDS             join(complement(926060..926215),complement(924556..925914))
FT                   /codon_start=1
FT                   /gene_family="HOG000012406" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637384"
FT                   /orf_name="MICPUN_105296"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="binding"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="vacuolar proton-transporting V-type
FT                   ATPase, V1 domain"
FT                   /protein_id="ACO62251.1"
FT                   /db_xref="GO:0000221"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG317811"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199AC47"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z3"
FT                   /transl_table=1
FT                   /translation="MIHPTDDLREVLERGARWNALLTSRLVTDEDLQAIQRYELRDEDA
FT                   RADMMDEEGDACARAFLNVLGDVSQTEYVQYVLALVARMLSDDKTRAAHFLAVEKKDDD
FT                   DKGQGGGGGGGGGEAYAVFLRLLAAPDWFTREKAMFCLTRLIDQRPARDKGLRFSEDGE
FT                   PATPAGVAAVRLSRWLCQELSADPPFHPQRAVPSCVTALASLLSIREVRPVATRAGAAR
FT                   AIAPLLKVAAGPHNVQELYEAGLCAWLLTFHPPACDAMARCGVIRGLMEVAGAAAKEKV
FT                   VRVATLALRNLASATGARETRGEEEAEAGSDGTRTAGDGGGGGVVGVSGVVGVSLVAQE
FT                   SALRKLVQNLRLRDFHDEELLAALADLEDGVLARRKEASSWDRYRAEVTSGALDWTAAH
FT                   IDEGFWRENASKLTDNNCQLLRMLVAAASDPGAEPRTLAVVCHDLGEFATHYPAGRFLV
FT                   QDLKGKDCAMRLLAHADDEVRKQALLCTQKLLVQKWQFLGGEVSSA"
     MIHPTDDLRE VLERGARWNA LLTSRLVTDE DLQAIQRYEL RDEDARADMM DEEGDACARA        60
     FLNVLGDVSQ TEYVQYVLAL VARMLSDDKT RAAHFLAVEK KDDDDKGQGG GGGGGGGEAY       120
     AVFLRLLAAP DWFTREKAMF CLTRLIDQRP ARDKGLRFSE DGEPATPAGV AAVRLSRWLC       180
     QELSADPPFH PQRAVPSCVT ALASLLSIRE VRPVATRAGA ARAIAPLLKV AAGPHNVQEL       240
     YEAGLCAWLL TFHPPACDAM ARCGVIRGLM EVAGAAAKEK VVRVATLALR NLASATGARE       300
     TRGEEEAEAG SDGTRTAGDG GGGGVVGVSG VVGVSLVAQE SALRKLVQNL RLRDFHDEEL       360
     LAALADLEDG VLARRKEASS WDRYRAEVTS GALDWTAAHI DEGFWRENAS KLTDNNCQLL       420
     RMLVAAASDP GAEPRTLAVV CHDLGEFATH YPAGRFLVQD LKGKDCAMRL LAHADDEVRK       480
     QALLCTQKLL VQKWQFLGGE VSSA                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page