(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE467

MICSR_1.PE467        Location/Qualifiers
FT   CDS             929164..930042
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637385"
FT                   /orf_name="MICPUN_52266"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61828.1"
FT                   /db_xref="UniParc:UPI000199AC48"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z4"
FT                   /transl_table=1
FT                   /translation="MWGITQALDLIDSAWGFASLDEDDEFLPSLDEDDIPVPSANFGFG
FT                   GGFYNNAFKRDFGVPIGKPQYDWTAPKAAPSLRSSEAADALELWAGAAGRLFAGEAEPL
FT                   IFRGGVDPSTLLREIPDVGMTIDEDEDEDEDIDLEDTARRDAVDAGFSLGWFSSPLGGN
FT                   DTGAYRFVVRDDEPAGPAAAAVGRDGIAVVIDEELRPVGVLRGSPDAMFFDVDAKVREV
FT                   MGMSPAVIEGDTATVGDVAVVCAAAAHDEPVAITDSEGRLRRVLRQEDLLEPIRSQLRE
FT                   QSESRFGNATR"
     MWGITQALDL IDSAWGFASL DEDDEFLPSL DEDDIPVPSA NFGFGGGFYN NAFKRDFGVP        60
     IGKPQYDWTA PKAAPSLRSS EAADALELWA GAAGRLFAGE AEPLIFRGGV DPSTLLREIP       120
     DVGMTIDEDE DEDEDIDLED TARRDAVDAG FSLGWFSSPL GGNDTGAYRF VVRDDEPAGP       180
     AAAAVGRDGI AVVIDEELRP VGVLRGSPDA MFFDVDAKVR EVMGMSPAVI EGDTATVGDV       240
     AVVCAAAAHD EPVAITDSEG RLRRVLRQED LLEPIRSQLR EQSESRFGNA TR               292
//

If you have problems or comments...

PBIL Back to PBIL home page