(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE468

MICSR_1.PE468        Location/Qualifiers
FT   CDS             complement(<930095..>930757)
FT                   /codon_start=1
FT                   /gene_family="HOG000230756" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637386"
FT                   /orf_name="MICPUN_71655"
FT                   /product="Predicted protein"
FT                   /function="phosphoribosylaminoimidazole carboxylase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="ACO62252.1"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="HOGENOM:HBG539656"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="UniParc:UPI000199AC49"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z5"
FT                   /transl_table=1
FT                   /translation="DFAKLDLGRTARTGLPEVVWGPGKTPEQIAKIMLALRDRQSAVMA
FT                   TRVDPEVYERIRAIEPSIEYDAFARVCTLAGAPDAPPTPVVRGILAVLTAGTADLAVAE
FT                   EAAITARLMGVEDVRLIADVGVAGLQRLLSRLDEVREADVVMVVAGMDGALPSVCAGLV
FT                   DAPVIAVPTSVGYGAAMGGLSPLMATLNSCATGVTVVNIDNGFGATMSAIKMLRAAER"
     DFAKLDLGRT ARTGLPEVVW GPGKTPEQIA KIMLALRDRQ SAVMATRVDP EVYERIRAIE        60
     PSIEYDAFAR VCTLAGAPDA PPTPVVRGIL AVLTAGTADL AVAEEAAITA RLMGVEDVRL       120
     IADVGVAGLQ RLLSRLDEVR EADVVMVVAG MDGALPSVCA GLVDAPVIAV PTSVGYGAAM       180
     GGLSPLMATL NSCATGVTVV NIDNGFGATM SAIKMLRAAE R                           221
//

If you have problems or comments...

PBIL Back to PBIL home page